KEGG   Verrucosispora maris: VAB18032_26821Help
Entry
VAB18032_26821    CDS       T01471                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
vma  Verrucosispora maris
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    VAB18032_26821
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VAB18032_26821
Enzymes [BR:vma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     VAB18032_26821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4955975..4957468)
Genome map
AA seq 497 aa AA seqDB search
MTGIRLGDLAARLAVAPPTTVDATVTGVTHASGEVHPGDLYAALPGARRHGAEFVADAAA
AGAVAVLTDAAGAELAAGYGLPTLVVADPRAVLGTLASAVYGDPTEKLTVIGVTGTAGKT
STAYLVESGLRAAGHTTGLIGTVETRLGDLVLDSVRTTPEATDLHAMLAAALERGVTAVV
MEVSSHALAMGRVGGVRFDVGGWTNFGSDHLDFHADADDYFAAKARLFDGRCAHEVLNHD
DPALKALFKPATISYSAAGDPSATWWAEDVNGEGYAQRFTLHGPDGLVLDAGVALPGRHN
VANALLAVAVLVAAGVDAATAARGVAACGGVPGRLESVGVAGGVRGVVDYAHKTDAVVAV
LAALRELSSGRLICVIGAGGDRDRGKRPAMGAAAAKGADVVLVTDDNPRTEDPATIRAEV
LAGAYDAGTRTRIVEVAGRRAAIDEAVRQAEPGDVVAVLGKGHERGQEIAGEVFPFDDVT
ELADALRARFGSLGGQR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggaatccggctcggtgacctagccgcccggctcgccgtggcgccccccaccacc
gtcgatgcgacggtgaccggggtgacccacgccagcggtgaggtccaccccggcgacctg
tacgcggccctgcccggtgcccggcggcacggcgcggagttcgtcgccgacgcggcggcg
gccggcgcggtcgccgtgctcaccgatgcggccggtgccgaactggccgccgggtacgga
ctgccgaccctggtggtggccgacccgcgtgcggtgctcggcacgctcgcctcggccgtc
tacggcgacccgaccgagaagttgacggtgatcggggtgaccggcacggccggcaagacc
tccaccgcgtacctcgtcgagtcggggttgcgggccgccggtcacaccaccggcctgatc
ggcaccgtggagacccgcctcggcgatctggtgctggacagcgtacggaccacgccggag
gccaccgacctgcacgcgatgctcgctgccgcgctcgaacgcggcgtcaccgcggtggtc
atggaggtgtccagccacgccctggcgatggggcgggtcggcggggtgcgcttcgacgtg
ggtggctggaccaacttcggctccgaccacctcgacttccacgccgacgccgacgactac
ttcgcggccaaggcccgactgttcgacggccgctgcgcccacgaggtgctcaaccatgac
gacccggcgctgaaggccctgttcaagcccgccacgatcagctactcggccgccggtgac
ccctccgccacctggtgggcggaggacgtcaacggcgaggggtacgcccagcggttcacc
ctgcacggcccggacgggctggtcctcgacgccggggtggcgctgcccggacggcacaac
gtggcgaacgccctgctggccgtcgccgtgctggtcgccgccggggtggatgcggccacc
gcggcgcggggggtggccgcctgcggcggcgtaccggggcggctggagtcggtgggcgtg
gccggcggggtacgcggcgtcgtcgactacgcgcacaagaccgacgcggtggtggccgtc
ctggccgccctgcgggaactgagcagcggccggctgatctgcgtgatcggcgcgggcggt
gaccgggaccggggcaagcggccggcgatgggcgcggccgccgcaaagggagccgacgtg
gtgctggtgaccgacgacaacccgcgcaccgaggacccggcgacgatccgcgccgaggtg
ctcgccggggcgtacgacgccgggacgcggacccggatcgtcgaggtggccgggcggcgc
gcggccatcgacgaggcggtccgccaggccgaacctggcgatgtggtggcggtgctcggc
aagggccacgaacgtggtcaggagatcgccggtgaggtgtttccgttcgacgacgtgacc
gaactggccgacgcgctgcgggcccgcttcggcagcctgggaggccagcgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system