KEGG   Verrucosispora maris: VAB18032_27011Help
Entry
VAB18032_27011    CDS       T01471                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
vma  Verrucosispora maris
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    VAB18032_27011
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VAB18032_27011
Enzymes [BR:vma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     VAB18032_27011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5004033..5004518
Genome map
AA seq 161 aa AA seqDB search
MSVFDTTINSLTGGPADLAQYRGRALLVVNVASRCGLTPQYAGLQALQDEYADRGLVVLG
VPCNQFAGQEPGSAAEISEFCQVNYGVTFPLTEKVAVNGPDRHPLYAALVDTPDADGHTG
DVRWNFEKFLVAPDGTVAARFAPTVTPDDPTLRATVEKTLP
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcttcgacaccacgatcaactccctcaccggcggccccgccgatctcgcgcag
taccgcgggcgcgccctgctggtggtcaacgtcgcctcccgctgcggcctcaccccgcag
tacgccggcctgcaggcccttcaggacgagtacgccgaccgcgggctggtggtactcggc
gtcccgtgcaaccagttcgccggccaggaacccggtagcgctgcggagatcagcgagttc
tgccaggtcaactacggcgtcaccttcccgctgacggagaaggtcgcggtgaacggcccc
gaccgtcatccgctctacgccgccctggtggacacccccgacgccgacggccacaccggt
gacgtccgttggaacttcgagaagttcctggtcgccccggacgggaccgtggccgcccgc
ttcgccccgacggtcacccccgacgaccccacgctgcgcgccaccgtggagaagaccctg
ccctga

DBGET integrated database retrieval system