KEGG   Verrucosispora maris: VAB18032_27106Help
Entry
VAB18032_27106    CDS       T01471                                 

Definition
(GenBank) glucokinase, rok family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
vma  Verrucosispora maris
Pathway
vma00010  Glycolysis / Gluconeogenesis
vma00052  Galactose metabolism
vma00500  Starch and sucrose metabolism
vma00520  Amino sugar and nucleotide sugar metabolism
vma00521  Streptomycin biosynthesis
vma01100  Metabolic pathways
vma01110  Biosynthesis of secondary metabolites
vma01120  Microbial metabolism in diverse environments
vma01130  Biosynthesis of antibiotics
vma01200  Carbon metabolism
Module
vma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VAB18032_27106
   00052 Galactose metabolism
    VAB18032_27106
   00500 Starch and sucrose metabolism
    VAB18032_27106
   00520 Amino sugar and nucleotide sugar metabolism
    VAB18032_27106
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    VAB18032_27106
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    VAB18032_27106
Enzymes [BR:vma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     VAB18032_27106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AEB46494
UniProt: F4F1R9
Position
complement(5024413..5025360)
Genome map
AA seq 315 aa AA seqDB search
MTLTIGVDVGGTKVAGGVVDDTGTVLVQTRRDTPADDVGKTRDVITELVAELAAGHDIQA
VGIGAAGWIDASRSTVLFAPNLAWRDEPLRAYVSAAVGLPVIVENDGNVAAWAEFRYGAA
RNADDSMVMFTIGTGVGGGIVLGGDLVRGANGIAAELGHMLTVPDGHQCGCGRLGCIEQY
ASGSALVRFARAAARQEPQRATALLELADGEAEAITGPMVTAAAKSGDPVSAEAFAQVGR
WLGTSMADMAQMLDPQVLVVGGGVIDAGELLMGPTRRSYAESLAQRSRLPVAEIRPAELG
NAAGVIGAADLARRI
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgaccatcggagtcgacgtgggtggcacgaaggtggccggcggtgtcgtcgac
gacaccggcacggtgctggtgcagacccgacgggacacccccgccgacgacgtgggcaag
acccgcgacgtcatcaccgaactggtcgccgaactggccgccggacacgacatccaggcg
gtcggcatcggcgcggccggctggatcgacgccagccgctcgaccgtgctgttcgccccg
aacctggcctggcgggacgagccgctgcgggcgtacgtcagcgcggcggtcggcctgccg
gtgatcgtcgagaacgacggcaacgtggccgcctgggcggagttccgctacggcgcggcc
cgcaacgccgacgactcgatggtcatgttcaccatcggcaccggcgtcggcggcggcatc
gtgctcggcggtgacctggtccggggtgccaacggcatcgccgccgaactgggtcacatg
ctcaccgtcccggacgggcaccagtgcggctgcggtcggctcggctgcatcgagcagtac
gccagcggcagcgccctggtgcgcttcgcccgcgctgcggcccggcaggagccgcagcgg
gccaccgcgctgctggaactcgccgacggcgaggccgaggcgatcaccggcccgatggtg
accgccgcggccaagagcggcgacccggtctccgccgaggcgttcgcccaggtcgggcgc
tggctcggcaccagcatggcggacatggcgcagatgctcgacccgcaggtgctggtcgtc
ggcggtggcgtcatcgacgccggtgagctgctgatgggcccgacccggcggtcgtacgcc
gagtcactcgcccaacgcagccggttgccggtggccgagatccgccccgcggagttgggt
aacgccgccggggtgatcggcgcggccgacctggcccggcggatctga

DBGET integrated database retrieval system