KEGG   Verrucosispora maris: VAB18032_27396Help
Entry
VAB18032_27396    CDS       T01471                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vma  Verrucosispora maris
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VAB18032_27396
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VAB18032_27396
  Amino acid metabolism
   00310 Lysine degradation
    VAB18032_27396
Enzymes [BR:vma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VAB18032_27396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5083908..5085740
Genome map
AA seq 610 aa AA seqDB search
MPVSVTMPRLGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLTRIV
VGEDETAEVGSELAVISGEGESAGGPSERQAPAEHQESPPAEQAAEAAAQPQAEAEQSAV
QEPAEQPAPAAAPSGEGTPVQMPALGESVTEGTVTRWLKQVGETVEVDEPLLEVSTDKVD
TEIPSPVAGTVLEIKVPEDETAEVGATLAVIGAAGAAPAEAKPEPKPQAEAKPEPEPEAK
PQAEAKPEPQVSEPTPGTSYNEPAAEAETSPEPTKTEQAAVPPAPTAQPAAAPSANGEAA
GYVTPLVRKLASEHGVDLASVNGTGVGGRIRKQDVLDAAEKARAAKAAPAPAAAQPAAQA
QPAAKPQPSAKRGTTEKLPRIRAAIAKRMHQSLQETAQLTTVVEVDVTKVAKLRARAKDS
FLQRHGVKLSFLPFFALAAIEALQTYPIVQARMDLDAGTITYPDAENLGIAVDTERGLLV
PVIHNAGDLNLGGIAKRVADLAERTRTNKISPDEIAGATFTLTNTGSRGALFDTPIVPSP
QSAMLGTGAVVKRPVVVNDPELGEVIAVRSMVYLAMSYDHRIIDGADAARFLTAVKERLE
AGNFEAELGL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatcggtcaccatgccccggctcggcgagagcgtcaccgagggcaccgtcacg
cgctggctcaagcaggagggtgacaccgtcgaggtcgacgagcccctgctcgaggtgtcc
acggacaaggtcgacaccgagatcccgtccccggcggccggcgtgctgacccgcatcgtg
gtgggcgaggacgagacggcagaggtcggcagcgagctggcggtcatctccggcgagggc
gagtcggccggcggcccgtccgagcggcaggcccccgccgagcaccaggagtcaccgccc
gccgagcaggccgccgaggcggccgcgcagccgcaggccgaggcggagcagtcggccgtc
caggagccggccgagcagccggccccggccgccgcgccgtcgggcgagggcaccccggtg
cagatgcccgcgctgggcgagagcgtcaccgagggtacggtcacccgctggctcaagcag
gtcggcgagaccgtcgaggtggacgagccgctgctggaggtctccaccgacaaggtcgac
acggagatcccctcgccggtggccggcaccgtcctggagatcaaggtccccgaggacgag
accgccgaggtcggcgccacgctggccgtcatcggcgctgccggtgccgccccggccgag
gccaagcccgagccgaagccgcaggcggaagccaagccggagccggagcccgaggccaag
ccgcaggcggaggccaagccggagccgcaggtctccgagccgacgcccggcacgtcatac
aacgagccggccgcggaggcggagacctcgccggagccgaccaagaccgagcaggccgcc
gttcccccggccccgaccgcgcagcccgctgccgcacccagtgccaacggcgaggcggcc
ggttacgtgaccccgctggtacgcaagctggccagtgagcacggcgtggacctggcctcg
gtcaacggcaccggtgtcggtggccggatccgcaagcaggacgtgctggacgcggcggag
aaggcccgcgccgccaaggccgcgcccgccccggccgcagcacagccggcggcgcaggca
cagccggccgccaagccgcagccgagcgccaagcgtggcaccaccgagaagctgccgcgc
atccgcgccgccatcgccaagcggatgcaccagtcgcttcaggagaccgcgcagctgacc
acggtcgtcgaggtggacgtcaccaaggtcgccaagctgcgggcccgggccaaggactcg
ttcctgcagcggcacggcgtcaagctgtcgttcctgccgttcttcgccctggcggccatc
gaggcgctccagacgtacccgatcgtgcaggcccggatggacctcgacgccggcacgatc
acctacccggacgccgagaacctcggcatcgcggtggacaccgagcggggcctgctggtg
ccggtcatccacaacgccggtgacctcaaccttggcggcatcgccaagcgcgtcgccgac
ctggccgagcgcacccgcaccaacaagatcagcccggacgagatcgccggtgcgaccttc
acgctgaccaacaccggcagccggggcgcgctgttcgacaccccgatcgtgccgtcgccg
cagtcggcgatgctcggcacgggtgccgtggtcaagcgcccggtcgtggtcaacgacccc
gaactgggcgaggtcatcgcggtccgctcgatggtctacctggccatgtcgtacgaccac
cgcatcatcgacggtgccgacgcggcccgcttcctgaccgcggtcaaggagcggctcgag
gccggcaacttcgaggccgaactcggcctgtaa

DBGET integrated database retrieval system