KEGG   Verrucosispora maris: VAB18032_27396Help
Entry
VAB18032_27396    CDS       T01471                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vma  Verrucosispora maris
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VAB18032_27396
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VAB18032_27396
  Amino acid metabolism
   00310 Lysine degradation
    VAB18032_27396
Enzymes [BR:vma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VAB18032_27396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5083908..5085740
Genome map
AA seq 610 aa AA seqDB search
MPVSVTMPRLGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLTRIV
VGEDETAEVGSELAVISGEGESAGGPSERQAPAEHQESPPAEQAAEAAAQPQAEAEQSAV
QEPAEQPAPAAAPSGEGTPVQMPALGESVTEGTVTRWLKQVGETVEVDEPLLEVSTDKVD
TEIPSPVAGTVLEIKVPEDETAEVGATLAVIGAAGAAPAEAKPEPKPQAEAKPEPEPEAK
PQAEAKPEPQVSEPTPGTSYNEPAAEAETSPEPTKTEQAAVPPAPTAQPAAAPSANGEAA
GYVTPLVRKLASEHGVDLASVNGTGVGGRIRKQDVLDAAEKARAAKAAPAPAAAQPAAQA
QPAAKPQPSAKRGTTEKLPRIRAAIAKRMHQSLQETAQLTTVVEVDVTKVAKLRARAKDS
FLQRHGVKLSFLPFFALAAIEALQTYPIVQARMDLDAGTITYPDAENLGIAVDTERGLLV
PVIHNAGDLNLGGIAKRVADLAERTRTNKISPDEIAGATFTLTNTGSRGALFDTPIVPSP
QSAMLGTGAVVKRPVVVNDPELGEVIAVRSMVYLAMSYDHRIIDGADAARFLTAVKERLE
AGNFEAELGL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatcggtcaccatgccccggctcggcgagagcgtcaccgagggcaccgtcacg
cgctggctcaagcaggagggtgacaccgtcgaggtcgacgagcccctgctcgaggtgtcc
acggacaaggtcgacaccgagatcccgtccccggcggccggcgtgctgacccgcatcgtg
gtgggcgaggacgagacggcagaggtcggcagcgagctggcggtcatctccggcgagggc
gagtcggccggcggcccgtccgagcggcaggcccccgccgagcaccaggagtcaccgccc
gccgagcaggccgccgaggcggccgcgcagccgcaggccgaggcggagcagtcggccgtc
caggagccggccgagcagccggccccggccgccgcgccgtcgggcgagggcaccccggtg
cagatgcccgcgctgggcgagagcgtcaccgagggtacggtcacccgctggctcaagcag
gtcggcgagaccgtcgaggtggacgagccgctgctggaggtctccaccgacaaggtcgac
acggagatcccctcgccggtggccggcaccgtcctggagatcaaggtccccgaggacgag
accgccgaggtcggcgccacgctggccgtcatcggcgctgccggtgccgccccggccgag
gccaagcccgagccgaagccgcaggcggaagccaagccggagccggagcccgaggccaag
ccgcaggcggaggccaagccggagccgcaggtctccgagccgacgcccggcacgtcatac
aacgagccggccgcggaggcggagacctcgccggagccgaccaagaccgagcaggccgcc
gttcccccggccccgaccgcgcagcccgctgccgcacccagtgccaacggcgaggcggcc
ggttacgtgaccccgctggtacgcaagctggccagtgagcacggcgtggacctggcctcg
gtcaacggcaccggtgtcggtggccggatccgcaagcaggacgtgctggacgcggcggag
aaggcccgcgccgccaaggccgcgcccgccccggccgcagcacagccggcggcgcaggca
cagccggccgccaagccgcagccgagcgccaagcgtggcaccaccgagaagctgccgcgc
atccgcgccgccatcgccaagcggatgcaccagtcgcttcaggagaccgcgcagctgacc
acggtcgtcgaggtggacgtcaccaaggtcgccaagctgcgggcccgggccaaggactcg
ttcctgcagcggcacggcgtcaagctgtcgttcctgccgttcttcgccctggcggccatc
gaggcgctccagacgtacccgatcgtgcaggcccggatggacctcgacgccggcacgatc
acctacccggacgccgagaacctcggcatcgcggtggacaccgagcggggcctgctggtg
ccggtcatccacaacgccggtgacctcaaccttggcggcatcgccaagcgcgtcgccgac
ctggccgagcgcacccgcaccaacaagatcagcccggacgagatcgccggtgcgaccttc
acgctgaccaacaccggcagccggggcgcgctgttcgacaccccgatcgtgccgtcgccg
cagtcggcgatgctcggcacgggtgccgtggtcaagcgcccggtcgtggtcaacgacccc
gaactgggcgaggtcatcgcggtccgctcgatggtctacctggccatgtcgtacgaccac
cgcatcatcgacggtgccgacgcggcccgcttcctgaccgcggtcaaggagcggctcgag
gccggcaacttcgaggccgaactcggcctgtaa

DBGET integrated database retrieval system