KEGG   Verrucosispora maris: VAB18032_27836Help
Entry
VAB18032_27836    CDS       T01471                                 

Definition
pfkb domain-containing protein
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
vma  Verrucosispora maris
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:vma00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5182576..5183556
Genome map
AA seq 326 aa AA seqDB search
MTGHVMVFAPTPLLTVTVDQPSDVPELHLHPGGQGVWQARMVLSLGVDVVLCTALGGEIG
EVLAPLLVGEGVDLKVVNRDSGGSGGYVHDRRGGTRREIVDVPGQPLSRHELDELYNLAL
SEGLRAEVCVLSGPNDPSLVPADLYRRFAADLGANGSRVVVDLSGEHLTAVVDSGVFFLK
VSHEELIADGRAADDDEEQLTRAMYDLHAAGAENVVVSRAEKPALALVDGEVFEVLMPQL
EAADPRGAGDSMTAGVAAVVAQGGDVRTAIRTGAAAGALNVTRHGLGTGRVDSITGLVER
VQLEPASIRPQHRTTPDELAHRAGGR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgggcacgtcatggtcttcgcgcccacaccgctgctgaccgtcaccgtcgaccag
cccagcgacgtaccggagctgcacctgcaccccggcggacagggcgtctggcaggcccgg
atggtgctgtcgctcggtgtcgacgtggtgctctgcacggcgctcggcggcgagatcggg
gaggtcctggcgccgctgctggtcggcgagggagtggacctcaaggtggtgaaccgcgac
tccggcggcagcggcgggtacgtgcacgaccgccgcgggggcacccggcgggagatcgtc
gacgtgcccggccaaccgttgagccggcacgagctggacgagttgtacaacctcgccctc
agcgaagggctgcgcgcggaggtgtgcgtgctcagcggcccgaacgacccgtcactggtg
cccgctgacctgtaccgccgtttcgccgccgacctcggcgccaacggcagccgggtggtg
gtggacctcagtggcgaacacctgacggcggtcgtggacagcggcgtgttcttcctcaag
gtcagccacgaggagctgatcgcggacggccgagccgccgacgacgacgaggaacagctc
acccgcgccatgtacgacctgcacgccgccggtgcggagaacgtggtggtcagtcgggcc
gagaagccggcgctggccctggtcgacggcgaggtgttcgaggtcctgatgccccagttg
gaagcggccgacccgcgtggggcgggcgactcgatgaccgccggggtggccgccgtggtg
gcccagggcggcgacgtccgcaccgccatccgtaccggggcggcggccggcgcgctgaac
gtcacgcgtcacgggctgggcaccggtcgggtcgactcgatcaccggcctggtcgagcgg
gtgcagctggagccggcgagcatccggccgcagcaccgcacgacccccgacgagctggcc
caccgggcgggcgggcgatga

DBGET integrated database retrieval system