KEGG   Verrucosispora maris: VAB18032_28171Help
Entry
VAB18032_28171    CDS       T01471                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vma  Verrucosispora maris
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VAB18032_28171
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VAB18032_28171
Enzymes [BR:vma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VAB18032_28171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5263290..5265110
Genome map
AA seq 606 aa AA seqDB search
MSSEPSLSSPPDTPPQPLHPAESTTRTAEELAGAAERAAATQLAPAAPVRLGSVVQLGAV
VQLGSVVRLGEVIPAPERVEPDPDADHLLTADAVIRVSADPAALAVGEQLAALLRPATGY
PLPVTDVVGQPPAGGIALQLTDEADLGAEGYRLDVTRDGVRLRARTAAGLHHGVQTLRQL
LPAAIESRTPVAERWVLPGGSILDRPRYPHRGAMLDVARHFFGVADVLRVIDHLARYKLN
RLHLHLTDDQGWRIAIDSWPRLAAVGGATEVGGGPGGHYTQADYRRIVAYAAARHITVIP
EIDLPGHTNAALVAHPELAPPGTTPSPYAGTEIGFSYVDPTSERTYDFVADVLGELAALT
PGPWLHIGGDEAFKVPAEVYTRFVERVQRIVTGLGKTVIGWHQIAPAAHTDGRILQWWGT
RPDDPTTADAVRRGAKLILSPANHAYLDMKYAPDTPIGHDWAAHIDVHQAYDWDPATHLT
DVPADAVLGVEAPLWTESVTTRTEIEFMLFPRLPAIAELAWSPQSPQPHPSAQSDRAAQS
DRAAQSDRAAHDWSDFRQRLAGHAPRWTAAGIAFHRSPDLPWPAQPSVPAPRPAPPAESA
PHTAQG
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
ttgtcctcggagccgtcgttgtcctcgccgcctgacaccccaccgcagccgctgcacccg
gccgagagcaccacgcgtaccgccgaggagttggcgggcgcggcggagcgggcggcggcg
acgcagctcgccccggccgcgccggtccggctcggttcggtggtgcagctgggcgcggtg
gtccagttgggttcggtggtccggctgggcgaggtgatcccggcgcccgagcgggtcgag
ccggatcccgacgccgaccacctgctgaccgccgacgcggtgatccgggtcagcgccgac
ccggccgcactggccgtcggcgaacaactcgccgcgctgctccgtcccgccaccgggtac
ccgctgccggtgaccgacgtggtcgggcaaccgcccgccggcggcatcgccctgcaactg
accgacgaggccgacctcggcgccgagggataccggctcgacgtcacacgcgacggggta
cgcctgcgcgcccgcaccgccgccggtctgcaccacggggtgcagacactgcgccaactg
ctacccgccgccatcgagagccgcaccccggtcgccgagcggtgggtgctgcccggcggg
tcgatcctcgaccgcccccggtacccgcaccgaggcgccatgctcgacgtggcccggcac
ttcttcggcgtcgccgacgtgctgcgggtcatcgaccacctggcccggtacaagctcaac
cggctgcacctgcacctcaccgacgaccaggggtggcggatcgccatcgactcctggccc
cgactggccgccgtcggcggggcgaccgaggtcggtggcggccccggcgggcactacacc
caggccgactaccggcgcatcgtggcgtacgccgccgcccggcacatcaccgtcatcccc
gagatcgacctgcccggccacaccaacgccgcgctggtcgcccaccccgaactggcaccc
ccgggaacaaccccgtcgccgtacgccggcaccgagatcgggttcagctacgtcgacccg
acaagcgagcggacgtacgacttcgtcgccgacgtcctcggcgaactcgccgcgctcacc
cccggcccgtggctgcacatcggcggcgacgaggcgttcaaggtgcccgccgaggtctac
acccgcttcgtcgaacgggtacaacgaatcgtgaccgggctcggcaagacggtcatcggc
tggcaccagatcgcccccgccgcgcacaccgacggccggatcctgcagtggtggggcacc
cgccccgacgacccgaccaccgccgacgcggtacgccggggcgccaaactgatcctctcc
cccgccaaccacgcctacctggatatgaagtacgccccggacaccccgatcggccacgac
tgggccgcccacatcgacgtgcaccaggcgtacgactgggaccccgccacccacctgacc
gacgtaccggccgacgcggtgctcggcgtcgaggcaccgctctggaccgagtccgtcacc
acccgcaccgagatcgagttcatgctcttcccccgactccccgcaatcgccgaactggcc
tggtccccccagtccccccagccccacccgtccgcccagtccgaccgggccgcccagtcc
gaccgggccgcccagtccgaccgggccgctcacgactggtccgactttcggcagcggctg
gccggccacgccccgcgctggacggcggcgggaatcgccttccaccgctcgcccgaccta
ccctggccggcgcagccctcagtccccgcgccccgacccgcgccgcctgccgaaagcgcg
ccccataccgcccaaggctga

DBGET integrated database retrieval system