KEGG   Verrucosispora maris: VAB18032_28751Help
Entry
VAB18032_28751    CDS       T01471                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
vma  Verrucosispora maris
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VAB18032_28751
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VAB18032_28751
   00650 Butanoate metabolism
    VAB18032_28751
  Amino acid metabolism
   00360 Phenylalanine metabolism
    VAB18032_28751
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VAB18032_28751
   00622 Xylene degradation
    VAB18032_28751
   00621 Dioxin degradation
    VAB18032_28751
Enzymes [BR:vma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VAB18032_28751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5387658..5388587)
Genome map
AA seq 309 aa AA seqDB search
MSVGVAVIGSGNIGTDLMIKVLRLSESLRMVAMVGIDPDSDGLARARRLGVATTAEGVDG
LVKMPEFADVELVFDATSAGAHRHNDAVLRAHGRRVVDLTPAAIGPYVVPPVNLDEHLTE
PNVNMVTCGGQATVPIVAAVRRVTPVAYGEIVASISSRSAGPGTRANIDEFTETTARAIE
VVGGADRGKAIIVLNPAEPPLLMRDTVYCLCPDPDADRSAIAASVADMVVGVQEYVPGYR
LKQDVQFDRVDTYVPSLGRQLTGLQVSVFLEVSGAGHYLPAYAGNLDIMTSAALRTAERL
VALRGTVSA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcggtgtggcggtgatcgggtcgggcaacatcggcaccgacctgatgatcaag
gtactgcggctcagtgagagcctgcggatggtggcgatggtcggcatcgacccggactcc
gacggtctggcccgggcccgccgcctcggcgtggcgaccaccgccgaaggcgtggacggc
ctggtgaagatgcccgagttcgccgacgtcgaactggtcttcgacgccacctccgccggt
gcgcaccgacacaacgacgcggtgctgcgcgcccatggccgccgggtcgtcgacctgacc
ccggccgctatcggcccgtacgtggtgccgccggtcaacctggacgagcacctgaccgag
ccgaacgtcaacatggtcacctgcggcggtcaggcgaccgtgccgatcgtcgccgcggta
cgccgggtcaccccggtggcgtacggcgagatcgtcgcctcgatctcctcccgttcggcc
ggtccgggcacccgcgccaacatcgacgagttcaccgagaccaccgcgcgggccatcgag
gtggtcggcggcgccgaccggggcaaggcgatcatcgtgctcaacccggcggagccgccg
ctgctgatgcgcgacaccgtctactgcctctgcccggatccggacgccgaccggtccgcc
atcgccgcctcggtcgccgacatggtcgtcggcgtgcaggagtacgtccccggttaccgg
ctcaagcaggacgtgcagttcgaccgggtggacacctacgtgccgtcgctcgggcggcag
ctgaccggccttcaggtctcggtcttcctggaggtctccggtgccgggcactacctgccc
gcgtacgccgggaacctggacatcatgacctcggccgcgctgcgtaccgccgagcggctg
gtcgccctccgcgggacggtgagcgcatga

DBGET integrated database retrieval system