KEGG   Vulcanisaeta moutnovskia: VMUT_0036Help
Entry
VMUT_0036         CDS       T01440                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vmo01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:vmo00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
37754..39022
Genome map
AA seq 422 aa AA seqDB search
MSSMYESISRKVDELRNEIINTLTHLISIPAVNPSYGGEGELEKANALLEIIRGWPFDEV
KRIDAPDRRAKGGVRPNILAIYRGKDESAGKLWIVTHLDVVPPGDLSAWTVTKPFEPKIV
GDKIYGRGTEDNGQSLVASLYAVKALMELGIRPRRTVVLAFVSDEEAGSDYGIKYLMSKH
PELFDKKDQALVPDAGNSDGSFIEVAEKSILWLKFKVYGKQTHGSTPHKGLNAHEVAITL
ANLLKNLLITKYSIRDALYEPPESTFEITMVSGTATSPNIVPGYHEFVMDSRVLPQYSLD
EVLRDIGNAINLVKAMYHRKIENEEVPRIEVETIQRLDAPKPTPTDAEIVKALVKVLRET
RGIEPKIGGIGGGTFAAYFRMLEIPAVVWSTIDEVAHQPNEYTKITNLINDTKTIATLIT
TI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcaatgtatgaatcgatctcgaggaaggttgatgaactacgtaatgaaataatc
aacacactaacccacctaataagcataccagcggtaaacccaagctacgggggagaagga
gagttggaaaaggcaaatgcactactcgagataataaggggttggcccttcgacgaagta
aaacgcatagacgcaccagacaggagggccaagggtggcgttagaccaaacatactagcc
atatacaggggcaaggacgagagtgcaggcaagctctggatagtgacccacctagacgtt
gtaccacccggcgacctaagcgcatggactgttacaaaaccctttgagccaaagatcgta
ggcgataaaatctatggcagaggtacagaggacaatggacaatcactggtggcatcacta
tacgcggtcaaggcattgatggaactcggcattaggcctaggaggaccgtggtactggcc
ttcgtaagcgacgaggaggcgggctcggactacggcataaaatacctaatgagcaaacac
ccagagctctttgacaagaaggaccaagccctagtaccagacgccggtaattcggatggt
agtttcatagaggttgccgagaaatcaatactatggctaaagttcaaggtgtatggtaag
cagacccacggtagtacgccacacaaggggttaaatgcacatgaggtagccataacccta
gccaacctactaaagaacctactgatcacaaaatacagcattagggacgcgctatatgaa
ccgcctgagtcaaccttcgaaataacaatggtaagcgggacagcaacctcaccgaacatc
gtacctggataccatgaattcgtaatggacagtagggtactaccacaatacagcctagac
gaagtactcagggacataggcaacgcaataaacctagtcaaggccatgtaccataggaag
atagagaacgaggaggtaccaaggatagaggtagagacaatacagaggctagacgcacca
aaaccaacacccacagacgcagagatagtaaaggcactggtaaaggtactgagggagaca
agaggaatagaaccaaaaataggaggaataggaggaggaacattcgcagcatacttcaga
atgctcgaaataccagccgtagtatggtcaacaatagacgaagtagcacaccaaccaaac
gaatacacaaaaataacaaacctaataaacgacacaaaaacaatagccacactaataacc
acaatataa

DBGET integrated database retrieval system