KEGG   Vulcanisaeta moutnovskia: VMUT_0077Help
Entry
VMUT_0077         CDS       T01440                                 

Definition
dTDP-glucose 4,6-dehydratase
Orthology
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:vmo00523]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of vancomycin group antibiotics
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:vmo00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
76070..77050
Genome map
AA seq 326 aa AA seqDB search
MGRYRILVTGGAGFIGSNFVRFSRYLGNDITVYDAFTYAGRYENLPRDVEVIKGDITDYD
RLKDVVQRIHPEIIVNFAAETHVDRSIVNPEPFIRTNVYGVYTILKIVKEFGTRLIHIST
DEVYGDMEGKEPADENTVLRPSNPYAATKAAGDALIMAFHRTYGVDAIIIRPSNNYGPYQ
YPEKLIPRTVIRALNDIPVVVHGDGSQRRDWLYVEDTCRAVLTIIEKGVSGEIYNVPGFN
EKSILQVVEDALRVLNKPKALIRFVSDRPGQDRRYIMKGDKILSLGWRPLVIWEDGLKKT
IKWYLENEWWWRPLLSDEFFRKDTPW
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgatacaggattctggttactggtggtgctggatttatcggtagtaattttgtt
agattttcacggtatttaggtaatgatatcacggtctatgatgcttttacgtatgctggt
cgttatgagaatttacctagggatgttgaggtgataaagggtgacattactgattatgat
aggttgaaggatgtcgtacagagaattcatcctgagatcatcgttaatttcgccgcggag
acacatgtcgataggagtatagtgaaccctgaaccctttattaggacgaatgtatatggg
gtatatacaatactaaagattgtgaaggaattcgggactaggcttatccatatatctacg
gatgaggtttacggtgacatggagggtaaggaacctgctgatgagaatacggtattgaga
ccaagtaatccttacgcagccacaaaggccgccggtgatgccttaataatggcatttcac
agaacctacggtgttgacgctattataatacgtccatctaacaattacggtccttaccaa
taccctgaaaagttaataccaagaaccgtgattagagctcttaacgatatcccagtcgtt
gtccatggtgacgggtcacagaggagagattggctttatgttgaggatacctgcagggca
gtcctaacgattatcgagaagggagtatccggcgaaatctataatgtgccgggctttaat
gaaaaaagcattcttcaggttgttgaggatgcactacgggtacttaataagccgaaggcg
ttgatacgtttcgttagtgatagacctggccaagatagaagatacatcatgaagggagat
aagattttgtccttgggctggagaccattggttatttgggaagatggattgaagaagaca
attaagtggtacttagaaaatgagtggtggtggagaccgctccttagtgatgaattcttt
aggaaagacacaccgtggtga

DBGET integrated database retrieval system