KEGG   Vulcanisaeta moutnovskia: VMUT_0077Help
Entry
VMUT_0077         CDS       T01440                                 

Definition
dTDP-glucose 4,6-dehydratase
Orthology
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    VMUT_0077
   01055 Biosynthesis of vancomycin group antibiotics
    VMUT_0077
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    VMUT_0077
Enzymes [BR:vmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     VMUT_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
76070..77050
Genome map
AA seq 326 aa AA seqDB search
MGRYRILVTGGAGFIGSNFVRFSRYLGNDITVYDAFTYAGRYENLPRDVEVIKGDITDYD
RLKDVVQRIHPEIIVNFAAETHVDRSIVNPEPFIRTNVYGVYTILKIVKEFGTRLIHIST
DEVYGDMEGKEPADENTVLRPSNPYAATKAAGDALIMAFHRTYGVDAIIIRPSNNYGPYQ
YPEKLIPRTVIRALNDIPVVVHGDGSQRRDWLYVEDTCRAVLTIIEKGVSGEIYNVPGFN
EKSILQVVEDALRVLNKPKALIRFVSDRPGQDRRYIMKGDKILSLGWRPLVIWEDGLKKT
IKWYLENEWWWRPLLSDEFFRKDTPW
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgatacaggattctggttactggtggtgctggatttatcggtagtaattttgtt
agattttcacggtatttaggtaatgatatcacggtctatgatgcttttacgtatgctggt
cgttatgagaatttacctagggatgttgaggtgataaagggtgacattactgattatgat
aggttgaaggatgtcgtacagagaattcatcctgagatcatcgttaatttcgccgcggag
acacatgtcgataggagtatagtgaaccctgaaccctttattaggacgaatgtatatggg
gtatatacaatactaaagattgtgaaggaattcgggactaggcttatccatatatctacg
gatgaggtttacggtgacatggagggtaaggaacctgctgatgagaatacggtattgaga
ccaagtaatccttacgcagccacaaaggccgccggtgatgccttaataatggcatttcac
agaacctacggtgttgacgctattataatacgtccatctaacaattacggtccttaccaa
taccctgaaaagttaataccaagaaccgtgattagagctcttaacgatatcccagtcgtt
gtccatggtgacgggtcacagaggagagattggctttatgttgaggatacctgcagggca
gtcctaacgattatcgagaagggagtatccggcgaaatctataatgtgccgggctttaat
gaaaaaagcattcttcaggttgttgaggatgcactacgggtacttaataagccgaaggcg
ttgatacgtttcgttagtgatagacctggccaagatagaagatacatcatgaagggagat
aagattttgtccttgggctggagaccattggttatttgggaagatggattgaagaagaca
attaagtggtacttagaaaatgagtggtggtggagaccgctccttagtgatgaattcttt
aggaaagacacaccgtggtga

DBGET integrated database retrieval system