KEGG   Vulcanisaeta moutnovskia: VMUT_0086Help
Entry
VMUT_0086         CDS       T01440                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VMUT_0086
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VMUT_0086
   00620 Pyruvate metabolism
    VMUT_0086
   00640 Propanoate metabolism
    VMUT_0086
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    VMUT_0086
   00680 Methane metabolism
    VMUT_0086
Enzymes [BR:vmo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     VMUT_0086
Lipid biosynthesis proteins [BR:vmo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   VMUT_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(87523..89529)
Genome map
AA seq 668 aa AA seqDB search
MSVTWALPFKEKIIPEIGRERAIDPEEYKRIHEESLKDIEAFWSNIARELEWFKPWDKAL
VADPQPPFYKWFVGGRLNASYLTLDRHVKGGRKNKVAIIWEGEPADQSGNPVEVRKLTYY
DLWREVNRFAYVLKNKLGLRKGDTIGIYMPMIPELPIAMLAAARLGVIFTVVFSGFTAQA
LADRLNDAETKLVITTDGGYRRGRVIRLKEIVDKALEQSPTVKNVVVYRRVGLNDVSMVK
GRDYWWHELMSDVPANTYVEPEPVESEHPLYILYTSGTTGKPKGIVHDTGGYMVLLHATM
KWVFDAREDDIHFCTADIGWVTGHSYIVFGPLLEGMTTILYEGAPDYPNPDRWWAIVERY
GVTIFYTSPTGIRTLMRFGDDWVRKHDLSTIRLMHSVGEPINPEAWRWLWKLAGRKKVPF
GSTWWMTETGGILISHAPGLALVPLKPGTNGPPLLGIDADVVDDNGNPIQPGQRGYLVIR
RPWPGMLLTIWKDPDRYVRTYWSKFPGMFYAGDYAVKDEDGYFWILGRADEVIKVAGHRL
GTYELESALIQHPAVAEAAVVGVPDPVRGEVPVAYVVLKQGYQPSEQLRAELNNTVREFV
GPIATLSNVFFVTKLPKTRSGKIMRRLVRAVVTGQSLGDVTTLEDEASVEEVKKAYEEFK
TELERLSK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttacatgggctctaccctttaaggagaaaataattcctgaaattggtagagaa
agagctattgatcctgaggagtataagaggattcatgaggagagccttaaggacatagag
gccttctggtctaatattgctagggaactcgagtggttcaagccctgggataaggccctg
gttgccgatccacagccaccattttataagtggtttgttggcggtaggttaaacgcatcg
tacctaacccttgataggcatgttaagggcggtaggaagaataaggttgccattatttgg
gagggcgaaccagctgatcagagtggtaatcctgttgaggttcgtaaactcacatactat
gacttatggcgcgaggtcaatagattcgcctacgtgcttaagaataagcttggccttagg
aagggcgataccataggtatctatatgcccatgatacctgagctcccaatagcaatgtta
gcggccgctagactcggcgtgatattcaccgtggtcttcagcggattcacggcacaggcc
ctagccgataggcttaatgatgcggagacaaagctcgtgataacaaccgatggtggttat
agacgcggcagggtaattaggcttaaggaaattgttgacaaggcccttgagcaatcacca
actgttaagaacgtagttgtctataggagggtcggccttaatgacgttagcatggttaag
ggcagggattactggtggcatgaattaatgagtgacgtaccagcgaatacatacgttgag
ccagaacctgtggagagtgagcacccattatatatactgtacacatcaggaactacgggt
aagcccaagggcattgttcacgatactggcggctacatggtgttactccatgcaacaatg
aagtgggtattcgatgctagggaggatgatattcacttctgcacagcagacattggctgg
gtcactgggcatagttacatcgtctttggcccgctccttgaaggcatgaccacaatacta
tatgaaggtgcacctgattatcccaacccagaccgttggtgggcaattgtggagaggtac
ggagttaccatattctatacaagtccaacgggtataagaacactgatgaggtttggcgat
gattgggttagaaaacatgacctaagcacaataaggctcatgcactcagtcggcgagcca
ataaacccagaggcctggaggtggctttggaaattagctggtaggaagaaggtacccttc
ggctccacttggtggatgacagagacaggaggcatactgatatcccatgcgccaggcctt
gccctggtaccgcttaagccaggtactaacggaccaccattgcttggtattgatgctgat
gttgttgatgataatggtaatccaatacaacctgggcaaagaggttacctagtgattagg
aggccatggccaggaatgctattgacgatttggaaagatcccgataggtatgtcaggaca
tactggagtaagttccctgggatgttttacgccggtgattacgcagttaaggatgaggac
ggctacttctggatacttggtagggctgacgaggttattaaggtggctggccataggctc
ggtacgtatgaactcgagtcagcgctgatacagcacccagctgtggctgaagcagctgtc
gttggtgttccagaccctgttaggggtgaggttcccgtggcctacgttgtcctaaagcag
ggttaccaaccctctgagcaattgagggctgagttaaataacacggttagggagtttgtg
ggtccaatagccacgttatctaatgtcttctttgtaacgaagctcccaaagacaaggagt
ggtaagataatgaggaggcttgttagggccgtggttactggccaatcattgggtgatgtg
acgacacttgaggacgaggcaagtgttgaggaggttaagaaggcatatgaagagtttaag
acggaattagagagactcagtaagtaa

DBGET integrated database retrieval system