KEGG   Vulcanisaeta moutnovskia: VMUT_0086Help
Entry
VMUT_0086         CDS       T01440                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vmo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vmo00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vmo00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vmo00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:vmo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(87523..89529)
Genome map
AA seq 668 aa AA seqDB search
MSVTWALPFKEKIIPEIGRERAIDPEEYKRIHEESLKDIEAFWSNIARELEWFKPWDKAL
VADPQPPFYKWFVGGRLNASYLTLDRHVKGGRKNKVAIIWEGEPADQSGNPVEVRKLTYY
DLWREVNRFAYVLKNKLGLRKGDTIGIYMPMIPELPIAMLAAARLGVIFTVVFSGFTAQA
LADRLNDAETKLVITTDGGYRRGRVIRLKEIVDKALEQSPTVKNVVVYRRVGLNDVSMVK
GRDYWWHELMSDVPANTYVEPEPVESEHPLYILYTSGTTGKPKGIVHDTGGYMVLLHATM
KWVFDAREDDIHFCTADIGWVTGHSYIVFGPLLEGMTTILYEGAPDYPNPDRWWAIVERY
GVTIFYTSPTGIRTLMRFGDDWVRKHDLSTIRLMHSVGEPINPEAWRWLWKLAGRKKVPF
GSTWWMTETGGILISHAPGLALVPLKPGTNGPPLLGIDADVVDDNGNPIQPGQRGYLVIR
RPWPGMLLTIWKDPDRYVRTYWSKFPGMFYAGDYAVKDEDGYFWILGRADEVIKVAGHRL
GTYELESALIQHPAVAEAAVVGVPDPVRGEVPVAYVVLKQGYQPSEQLRAELNNTVREFV
GPIATLSNVFFVTKLPKTRSGKIMRRLVRAVVTGQSLGDVTTLEDEASVEEVKKAYEEFK
TELERLSK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttacatgggctctaccctttaaggagaaaataattcctgaaattggtagagaa
agagctattgatcctgaggagtataagaggattcatgaggagagccttaaggacatagag
gccttctggtctaatattgctagggaactcgagtggttcaagccctgggataaggccctg
gttgccgatccacagccaccattttataagtggtttgttggcggtaggttaaacgcatcg
tacctaacccttgataggcatgttaagggcggtaggaagaataaggttgccattatttgg
gagggcgaaccagctgatcagagtggtaatcctgttgaggttcgtaaactcacatactat
gacttatggcgcgaggtcaatagattcgcctacgtgcttaagaataagcttggccttagg
aagggcgataccataggtatctatatgcccatgatacctgagctcccaatagcaatgtta
gcggccgctagactcggcgtgatattcaccgtggtcttcagcggattcacggcacaggcc
ctagccgataggcttaatgatgcggagacaaagctcgtgataacaaccgatggtggttat
agacgcggcagggtaattaggcttaaggaaattgttgacaaggcccttgagcaatcacca
actgttaagaacgtagttgtctataggagggtcggccttaatgacgttagcatggttaag
ggcagggattactggtggcatgaattaatgagtgacgtaccagcgaatacatacgttgag
ccagaacctgtggagagtgagcacccattatatatactgtacacatcaggaactacgggt
aagcccaagggcattgttcacgatactggcggctacatggtgttactccatgcaacaatg
aagtgggtattcgatgctagggaggatgatattcacttctgcacagcagacattggctgg
gtcactgggcatagttacatcgtctttggcccgctccttgaaggcatgaccacaatacta
tatgaaggtgcacctgattatcccaacccagaccgttggtgggcaattgtggagaggtac
ggagttaccatattctatacaagtccaacgggtataagaacactgatgaggtttggcgat
gattgggttagaaaacatgacctaagcacaataaggctcatgcactcagtcggcgagcca
ataaacccagaggcctggaggtggctttggaaattagctggtaggaagaaggtacccttc
ggctccacttggtggatgacagagacaggaggcatactgatatcccatgcgccaggcctt
gccctggtaccgcttaagccaggtactaacggaccaccattgcttggtattgatgctgat
gttgttgatgataatggtaatccaatacaacctgggcaaagaggttacctagtgattagg
aggccatggccaggaatgctattgacgatttggaaagatcccgataggtatgtcaggaca
tactggagtaagttccctgggatgttttacgccggtgattacgcagttaaggatgaggac
ggctacttctggatacttggtagggctgacgaggttattaaggtggctggccataggctc
ggtacgtatgaactcgagtcagcgctgatacagcacccagctgtggctgaagcagctgtc
gttggtgttccagaccctgttaggggtgaggttcccgtggcctacgttgtcctaaagcag
ggttaccaaccctctgagcaattgagggctgagttaaataacacggttagggagtttgtg
ggtccaatagccacgttatctaatgtcttctttgtaacgaagctcccaaagacaaggagt
ggtaagataatgaggaggcttgttagggccgtggttactggccaatcattgggtgatgtg
acgacacttgaggacgaggcaagtgttgaggaggttaagaaggcatatgaagagtttaag
acggaattagagagactcagtaagtaa

DBGET integrated database retrieval system