KEGG   Vulcanisaeta moutnovskia: VMUT_0098Help
Entry
VMUT_0098         CDS       T01440                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VMUT_0098
Enzymes [BR:vmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VMUT_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
100568..101533
Genome map
AA seq 321 aa AA seqDB search
MNKRTIVLSMGNLNLDIYVKTDAIPRPDESVDAYETYMGGGGSAANFSVAVARLGLGSRF
LGSVGNDQFGDMLIKELESEGVDTKFIKRISHEKTGTVIVIVGLDGSKRMIRYSGANLGL
TPNDITNDVMNGVSHVHVALGRTEIIEVAKRIAKSMGLTVSVDGGTPLAKKGLDVIKDIM
NDVDIWFMNSFEARELGHSENVVKAAENIVSRVRVRELIVTLGPRGALLLRDGEVKYSDA
FKVPPIDTTGAGDTFAAAYTVASVLDLDPIDKLVFANATASLKVTKRGARSSPKLNEVLD
FLNSLGYAKLTNEILTQLGQF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaaagaacgatagtactctcaatgggtaacctaaacctagatatttacgttaag
accgatgctataccaagacccgatgagtcggttgacgcatatgagacctatatgggtggt
ggaggttctgctgctaatttctccgttgcagtggcaaggcttgggcttggctctaggttc
cttgggtccgtgggtaatgaccaattcggcgacatgctgattaaggaattggaatccgag
ggtgttgatacaaagttcataaagcgcattagccatgaaaagactggaacagtgattgtg
attgtgggtctcgatggctctaaacgaatgattaggtattcaggggctaacctgggatta
acacccaacgatattactaatgatgtcatgaatggtgtatcacacgtccacgtggccctc
ggtagaaccgagattatcgaggtagcaaagcgcattgccaaatccatggggctaaccgtc
tctgttgatggaggtacaccattggctaaaaaggggcttgatgtgattaaggatataatg
aacgatgttgatatttggttcatgaacagctttgaggccagagaactaggtcattcagaa
aatgttgttaaggccgccgagaatatagtgagtagggttagggttagggagttaatagtt
acgcttggcccccgcggggcattgttgcttagagatggtgaggttaagtattcagatgca
tttaaggttcctccaatagatacgaccggtgctggtgacacatttgctgcggcttacact
gttgcttccgtactagacctggacccaatagataaacttgtttttgctaatgcaaccgca
tcacttaaggttactaagaggggggctaggtcgtcacctaagttaaatgaagtacttgat
ttcctgaattctcttggttatgctaagttgaccaatgaaatattgactcaactcgggcag
ttctaa

DBGET integrated database retrieval system