KEGG   Vulcanisaeta moutnovskia: VMUT_0118Help
Entry
VMUT_0118         CDS       T01440                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vmo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(119779..121353)
Genome map
AA seq 524 aa AA seqDB search
MTQEKRFILVIDQGTTGTRAALTSHNGSIIGYAYHEHSQVYPKPAWVEHNPMEIWEKTRL
VIKEVLEFTKVDPREIAAIGVTNQRETTVIWDPRNGQPVYNAIVWQDRRTSSMIDYLKQN
YLGVIQERTGLVPDAYFSGSKIWWLLDNVPGLRDRARKGEVVFGTIDTWLIWNLTRSNKD
VLTPERGGAHVTDYSNASRTMIFNIHKLDWDDELLEIEGKIPRDILPLPRPSSDSRIYGY
TGPEVSQLLGGVNIPVCGDAGDQQAALFGQVGFEVGEVKSTYGTGNFILMNIGDTPVRSR
ANLLTTVYYSIEEGKAEYALEGSIFITGAAVQWLRDGLKIIEVSDEIEPLAVSAPDTGGV
YFVPAFTGLGAPYWDQHARGLIIGITRGTERKHIARAVLEAIAYLNRDVLEAMVSDTGIK
IPRIKVDGGAARNNFLMQFQADITGIEVWRPVIFETTSLGAAYLAGLAIGLWKNLDEIAK
NWKLDRVFKPRMDIETRERLYRGWRAAVQRALGWAKEVPWAYGL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggagaagaggtttatattggttattgatcaagggaccactggtacgagggct
gccttgacttctcacaatggctcaataataggctatgcataccacgagcattcccaggtt
tacccaaaacctgcctgggttgagcataatccgatggagatttgggagaagactaggtta
gtgattaaggaggtccttgagttcacgaaggttgacccgagggaaatagcagctattgga
gtaactaatcagcgtgagaccacggttatttgggatccaaggaatggtcagccggtctac
aacgccattgtctggcaggacagaaggacatcatctatgattgactatttaaagcagaat
tacctgggcgtgattcaggagaggacaggtctcgttccagatgcttatttctccgggtca
aagatttggtggctccttgataatgtacctggacttagggacagggccaggaaaggcgag
gtggtctttggtaccatcgatacttggttaatttggaacctaactaggagtaataaggac
gtgctaacacccgagagaggcggtgcacatgttactgactatagtaatgcgtccaggacc
atgatatttaacatccataagcttgactgggatgatgaattgcttgagattgagggtaag
attcctcgagacatactacccttgccaagaccatcaagcgatagtaggatatacggttac
acgggccctgaggtttctcaactacttggtggcgtgaatattccggtttgtggcgatgct
ggtgatcaacaagcagctctctttggccaagttggttttgaggttggtgaggttaagtcg
acttacggtactgggaacttcatactaatgaatattggggatacaccagtaagatctagg
gcaaatctattaaccactgtttattactccattgaagaaggcaaggcagagtacgcactt
gagggtagtatattcatcactggagctgccgtacagtggttgagggatggtcttaagata
atagaggtttctgacgagatagagccattggcagtctcagcccccgataccggtggcgtt
tactttgtaccagcattcacgggacttggtgcgccgtattgggaccaacatgcccgtggg
cttataataggcattacacgtggtacagagaggaagcacattgccagggctgtccttgag
gcaatagcgtacctaaacagggatgttcttgaggccatggtgagcgatacgggaattaaa
atacccaggattaaggttgatggtggtgccgctaggaataacttcctaatgcagttccaa
gctgacataacgggtattgaagtctggagaccagtgatcttcgaaacaacatcgctgggc
gcagcttaccttgcgggtttagcgattggtctttggaaaaacctggatgaaattgccaag
aactggaaattggacagggtatttaagccgaggatggacatagaaacgagagagcggtta
tacaggggctggagggcggccgtacaaagagccctgggctgggctaaggaagttccatgg
gcttatggattatag

DBGET integrated database retrieval system