KEGG   Vulcanisaeta moutnovskia: VMUT_0345Help
Entry
VMUT_0345         CDS       T01440                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vmo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(334560..335471)
Genome map
AA seq 303 aa AA seqDB search
MGNNIDFYVASQYTLFGTPRCGRGIPILGIPMEDTVSFRPGTRFAPSIIRSWSQYFEFTP
TEDLGIDPLDKICDLGDLSLLQGMIDRNLERINLVVRDAISTWGRVINIGGEHTLSLGVA
KAVRESQGSYGIYIHVDAHLDSREEWPIGQSLSHATFVRHLINQVKPQLIVFLGFRSYDR
EEMNFVSRLENSILLSTRDVKSMNNHELRLLMRGAIDSYPGSIHLSIDVDVLDPSVMPGV
GNPEGFGLSYSELLRITKAILDYGDSRVKAVDIVEYSPPNDPGLMSLPTTIRLILDVLNY
IRT
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggtaataacattgatttttacgttgcatctcaatacacgcttttcggaacacctagg
tgcggccgtggtataccaatacttggtatacccatggaggataccgttagctttaggcct
gggacacgatttgcacccagcatcattagatcctggagtcagtactttgaatttacacct
acggaggacctgggtatagatccacttgataagatttgtgatttgggtgatttatcatta
ctgcagggtatgattgacaggaatttggagaggattaatctagttgttagggacgctatt
agtacgtggggtagggtaatcaatataggtggtgaacatacactaagtcttggtgttgct
aaggcggttagagaatcccagggttcatatggcatttacatacatgttgatgctcacttg
gattcaagagaggaatggccgatagggcaatccttatcgcatgcaacattcgtgaggcac
ttaattaatcaggttaagcctcaattgattgttttccttgggtttagatcatatgacagg
gaggagatgaatttcgtgagtagacttgaaaattccatactattgtcaactagggatgtg
aagtccatgaataaccatgaacttagactgctcatgaggggtgccattgatagttatcct
ggttcgatccacctgagcattgatgttgatgttcttgatccatcagtaatgcctggcgtc
ggtaatccagagggttttggacttagttatagcgagcttttgaggattactaaggctatt
cttgattacggtgattccagggttaaggccgttgacattgttgagtactcaccaccaaat
gatcctggtttaatgtcgttacccacaacaatcagattaatccttgatgtacttaattac
atacgtacttaa

DBGET integrated database retrieval system