KEGG   Vulcanisaeta moutnovskia: VMUT_0388Help
Entry
VMUT_0388         CDS       T01440                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VMUT_0388
Enzymes [BR:vmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     VMUT_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(374210..375265)
Genome map
AA seq 351 aa AA seqDB search
MDINLLSQLSTEVGPSGFEDRVRNVIRGLVNNDADEVKADNLGNLIARVGNGSFKVLISA
HMDEVGVMISHIDQRGFLRIVPIGGLDPWVLLDRELVFMGKDGDIVGVVGVDPPHLRKEK
PPSKFEELYVDAGFSSKDEALKSGVMPGTPGTFVGDFRQRGSMVIGKAFDNRVGCTVLID
TLKDIRNKVSGDVSLYFAWNTQEEVGLRGINAVVHQVNPHIAFIVETTVAADVPTSSEDV
WITRIGGGAALRAFDRSMIANPKLLSVAIELAEDKNIRYQVQVNPYGGTDAGIIHTYGAG
VPSLVISTPARYIHSPASLINTDDLRQVENLLKTLLLNLDLVRNKALISER
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggatataaatctgttgagccaattatcgacggaggttggtccttccggttttgaggat
agggttagaaacgtgattaggggtttagttaacaatgacgctgatgaggttaaggccgat
aatctgggcaacctaattgctagggttggtaatggttcatttaaggttctaattagtgct
catatggatgaggttggcgtaatgatctcgcacattgatcagaggggtttcctgagaata
gtacctattggtggtttagacccctgggtcctcttagatagggagttagtgtttatgggt
aaggatggagatatcgtcggtgtcgttggtgttgatccaccgcacttacgtaaggagaag
cctccatcaaagtttgaggagttatatgttgatgcaggctttagcagtaaggatgaagct
ttaaagagtggtgtaatgccaggaactccgggcacgttcgtgggtgattttaggcagagg
ggttccatggttattggtaaggcgtttgataatagggttggttgtacggttttaatagac
acgcttaaggacattaggaataaggtgagtggagatgtatcgctgtactttgcatggaat
acgcaggaggaggttggtcttaggggtattaatgctgttgttcatcaggtcaatccccac
atagcctttattgtcgagaccacagttgctgctgatgtaccgactagcagtgaggatgtt
tggataacgaggattggtggcggtgctgcgcttagggcttttgatagatcaatgattgct
aatcctaagttattatctgtggctatcgaactcgcagaagacaaaaatattaggtatcag
gtgcaggtcaatccatatggtggtacggatgcagggataatacatacttacggtgctggt
gtgccatcgttggttatttcgacacctgcgaggtacatacactcaccagcatcattaatt
aatactgacgatctaaggcaggttgagaatttactaaaaaccttgttactaaacctagac
ttagtcaggaataaggcgttgattagtgagagatga

DBGET integrated database retrieval system