KEGG   Vulcanisaeta moutnovskia: VMUT_0389Help
Entry
VMUT_0389         CDS       T01440                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
vmo00010  Glycolysis / Gluconeogenesis
vmo01100  Metabolic pathways
vmo01110  Biosynthesis of secondary metabolites
vmo01120  Microbial metabolism in diverse environments
vmo01130  Biosynthesis of antibiotics
vmo01200  Carbon metabolism
vmo01230  Biosynthesis of amino acids
Module
vmo_M00002  Glycolysis, core module involving three-carbon compounds
vmo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VMUT_0389
Enzymes [BR:vmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     VMUT_0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N GFO_IDH_MocA 2-Hacid_dh_C NAD_binding_3 F420_oxidored Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADY00602
UniProt: F0QU62
Position
complement(375311..376357)
Genome map
AA seq 348 aa AA seqDB search
MTVKIGIMGYGTIGKRIADAVMRMDDMELIGVIKQTPDYEGEVAISKGIKLYTYEDRVNK
FEKAGIRVTGTINDLIKNVDVIIDATPDGVGAENKAKIYEPLGLRAIFQGGEEAEVADTS
FNALANYDMAIGKRFIRVVSCNTTALSRLIGAFLIHGYKIRKVRAYLVRRGADPREFKKG
PINDVVFNPATVPSHHGPDVQTVIPTIDIITMAVAVPTTMMHLHMVNIEFDGQVSKGEIM
KILEETPRILLFNSASRKIESLAQIIEWARDLGRLRGDVMENALIEDSITVFQNELFLMQ
GVHQESIVVPENIDAVRAMFKLSSKWDSIRKTDLRLNLITTGKNYNLA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttaaaatcggtataatgggttacggaactattgggaagagaattgccgacgca
gtaatgagaatggacgacatggaattaatcggtgtaattaaacagacgccagattatgaa
ggtgaagttgccattagtaagggcattaagctatatacctatgaggatagagttaataaa
tttgagaaagctgggattagggttacaggtactatcaatgaccttattaagaatgttgat
gtaatcatcgatgcaacacccgatggcgttggtgctgagaataaggcaaagatatacgaa
ccactagggcttagggctatatttcagggtggtgaagaagcagaggttgctgacacaagc
tttaacgcgcttgctaattatgacatggccattggtaaaaggttcattagggttgttagc
tgcaacacaacagcactctcaagactaataggcgccttcctgatacatggctataagata
aggaaagttagagcatatttagtgagaagaggagccgatcccagggaatttaagaagggg
ccgattaatgacgtagtatttaatccagccacagtgcctagccaccatggacctgatgta
cagacggtaataccgaccattgacataattaccatggcagtagccgtacccacaacaatg
atgcacttgcacatggttaatattgagtttgatggccaggtaagtaagggcgagattatg
aagattcttgaggaaacacctaggatattgttgttcaattcagcgtcaagaaagatcgaa
tcccttgcacaaataatcgagtgggctagagatctcggtaggcttagaggtgatgttatg
gagaatgcactcatagaggattcaataactgtgtttcagaatgagctattcctcatgcag
ggcgtccaccaggaaagtattgtggttcctgagaacatcgatgccgtgagggctatgttt
aagctctccagtaagtgggattcaattaggaagacagacttaaggctgaatcttattacc
acgggaaagaattataaccttgcttaa

DBGET integrated database retrieval system