KEGG   Vulcanisaeta moutnovskia: VMUT_0397Help
Entry
VMUT_0397         CDS       T01440                                 

Definition
(GenBank) 2-Ketoisovalerate:ferredoxin oxidoreductase (VOR), beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
vmo00010  Glycolysis / Gluconeogenesis
vmo00020  Citrate cycle (TCA cycle)
vmo00620  Pyruvate metabolism
vmo00633  Nitrotoluene degradation
vmo00640  Propanoate metabolism
vmo00650  Butanoate metabolism
vmo00680  Methane metabolism
vmo00720  Carbon fixation pathways in prokaryotes
vmo01100  Metabolic pathways
vmo01120  Microbial metabolism in diverse environments
vmo01130  Biosynthesis of antibiotics
vmo01200  Carbon metabolism
Module
vmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VMUT_0397
   00020 Citrate cycle (TCA cycle)
    VMUT_0397
   00620 Pyruvate metabolism
    VMUT_0397
   00640 Propanoate metabolism
    VMUT_0397
   00650 Butanoate metabolism
    VMUT_0397
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    VMUT_0397
   00680 Methane metabolism
    VMUT_0397
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    VMUT_0397
Enzymes [BR:vmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     VMUT_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N E1_dh
Motif
Other DBs
NCBI-ProteinID: ADY00610
UniProt: F0QU70
Position
complement(384457..385371)
Genome map
AA seq 304 aa AA seqDB search
MMSMVTITELHKYGRTKFIMPGTAACPGCPLQVGMRQLAMALDGKFVMVIPAGCSSVIPG
SAPYTAYTVPVLHVPFASSPAVASGLVRAVRQRNNNGPVVVWAGDGATADIGFATLSGAA
YRNEDILYVMADNEAYMNTGIQASGTTSWMAWTTTSPKGKTEDKKDVALIMLMHKVPYVA
TASIAYPMDFIDKVRRAMQVRGFRFIHLHSPCPPGWKMDDSYTIKAARLAVETGAWILWE
YNQGRLTISPPSIPYKDKPRRRPLEEYIKIQGRFSHLKPEDIKLMEEKIDRQWDLILKLT
EIFK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgatgagcatggtcaccataaccgaactacataagtatggaagaacaaagttcataatg
ccaggcacggctgcatgccctggttgcccattacaggttggcatgagacaattagccatg
gcacttgatggtaagttcgtcatggtaataccagctggttgctcaagcgtaataccaggt
tctgccccatacactgcatacacagtacccgtacttcatgtaccatttgcatcaagccca
gcggtggctagtggtttagtaagggccgttaggcagaggaataataatggacctgtggtt
gtttgggctggtgatggtgctaccgccgatattggattcgccacattaagcggcgctgcc
tatagaaatgaggatattctatatgtaatggccgataatgaagcctacatgaatacgggc
attcaggccagtggcacaacttcctggatggcttggacaacaacatcacctaagggcaag
accgaggataagaaggacgtggcattaataatgctcatgcataaggttccctacgtagcc
acagcaagcattgcttacccaatggacttcatcgataaggttaggagggcaatgcaggtt
agaggctttagattcatacatctgcattcgccctgtccacctggttggaagatggatgat
tcctacacgattaaggctgctaggcttgctgttgagactggcgcctggatactttgggag
tacaatcagggcaggttaacgataagcccgccaagcattccgtataaggataagccaagg
aggaggccgctggaggagtatataaagattcagggtagattctcccatctaaagcccgag
gatattaagcttatggaggagaagatagataggcagtgggatctcattctcaagcttact
gagatttttaagtga

DBGET integrated database retrieval system