KEGG   Vulcanisaeta moutnovskia: VMUT_0399Help
Entry
VMUT_0399         CDS       T01440                                 

Definition
(GenBank) 2-Ketoisovalerate:ferredoxin oxidoreductase (VOR),delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
vmo00010  Glycolysis / Gluconeogenesis
vmo00020  Citrate cycle (TCA cycle)
vmo00620  Pyruvate metabolism
vmo00633  Nitrotoluene degradation
vmo00640  Propanoate metabolism
vmo00650  Butanoate metabolism
vmo00680  Methane metabolism
vmo00720  Carbon fixation pathways in prokaryotes
vmo01100  Metabolic pathways
vmo01120  Microbial metabolism in diverse environments
vmo01130  Biosynthesis of antibiotics
vmo01200  Carbon metabolism
Module
vmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VMUT_0399
   00020 Citrate cycle (TCA cycle)
    VMUT_0399
   00620 Pyruvate metabolism
    VMUT_0399
   00640 Propanoate metabolism
    VMUT_0399
   00650 Butanoate metabolism
    VMUT_0399
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    VMUT_0399
   00680 Methane metabolism
    VMUT_0399
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    VMUT_0399
Enzymes [BR:vmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     VMUT_0399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_21 Fer4_6 Fer4_16 Fer4_10 Fer4_2 Fer4_9 Fer4_17 Fer4_8 Fer4_15 Fer4_13 Fer4_4 Fer4_22 DUF5412 MerT Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADY00612
UniProt: F0QU72
Position
complement(386583..386858)
Genome map
AA seq 91 aa AA seqDB search
MKTAEKLRGLLLSTPAEGAGGRTGTWRVYRPVVNYSKCTKCGICWLYCPENVIEWLEDKN
IKINYDYCKGCGICADVCPVKAIDMVKEEVV
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcagagaagttaaggggtctcttgctgtcgactcctgctgaaggtgctggc
ggtaggacaggtacttggcgtgtatatagaccagtcgttaattattctaaatgtacgaag
tgcggcatttgttggctttattgccctgaaaatgtcattgagtggcttgaggataagaat
attaagattaattatgactattgcaagggctgtggaatttgtgctgatgtctgtccagtc
aaggcaatagatatggttaaggaggaggtggtgtga

DBGET integrated database retrieval system