KEGG   Vulcanisaeta moutnovskia: VMUT_0423Help
Entry
VMUT_0423         CDS       T01440                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VMUT_0423
Enzymes [BR:vmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     VMUT_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(410454..411029)
Genome map
AA seq 191 aa AA seqDB search
MNETSLRRSLVEIFRLAYARKLVDLLGGNASARLSNDEVLITPTSMPKILIKPQSIVKIR
LDGTIISGSNPSSEWRMHVGIYKARNDAKFILHTHPPNILALSRAGLKIDLSLSEAISYV
GEVVEVPYLKPGSAELANAVSKAVSRRGVTAVILRNHGLVTLGSTPYEALNRAEVLEDLA
YITLISNCSSK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaacatcattaagaagatcacttgttgagatctttagattagcatatgcaaga
aaactcgtagacctacttggcggaaatgccagtgctaggttgagtaatgatgaggttttg
ataacaccgacatcgatgccaaagatactcataaagccgcagagcatcgtcaagattagg
cttgatggaacaatcatatccggcagcaatcccagcagtgagtggaggatgcacgtaggt
atttataaggctaggaatgatgctaagtttatacttcatactcacccacccaatatattg
gcattaagcagagccggtcttaagattgacctatcacttagtgaggcgatatcatacgtt
ggtgaagttgttgaggtgccttacctgaaacctggaagtgctgagttggccaatgccgtt
agtaaggcagtgtctagaaggggcgtgaccgctgtgattctaaggaatcatggattagtc
acactaggttcaacaccgtatgaagcacttaatagggctgaggttcttgaagaccttgct
tacataacattaatatctaactgttccagtaagtaa

DBGET integrated database retrieval system