KEGG   Vulcanisaeta moutnovskia: VMUT_0682Help
Entry
VMUT_0682         CDS       T01440                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VMUT_0682
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VMUT_0682
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VMUT_0682
Enzymes [BR:vmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VMUT_0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(656646..657941)
Genome map
AA seq 431 aa AA seqDB search
MEKYRIDLPVDEIPTHWYNILADLPEPLSPPYDPDNGKRLELLKQVIPSEPLRLEFSTER
FVKIPEEVLERYLQVGRPTPLVRAKRFEEYLNAPVKIYLKMEGYTYTGSHKINSALAWVY
YALKDGAKFVTTETGAGQWGSAVALAAALFKVKAYVFMVRASYYAKPLRRYLMQMYGADV
NPSPSDLTEFGRKLLRENPNHPGSLGIAITESAEYALKNGGKYVVGSVINADIMFKTIAG
LEAKKQMELIGEDPDVMIGVVGGGSNWGGAFYSFIGDELRSGKVRRRYIAVGALEVPKVT
KGVYKYDDPDTGRVLPQLKMYTIGADFIPPPIYAGGLRYHAVAPTLSYLMSKGYVEGRDY
DQEAVFKMAQIFAQVEGYVPAPETAHVLPVVKEIADEARRTGERKVILISFSGHGLLDLS
NYADVLGFEKA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatagaatagaccttcccgtagatgaaatacccacgcactggtacaacata
ctcgcagacctaccagaaccactatcaccaccatacgacccagacaatggcaaaaggctt
gagctcctgaagcaagtaataccatcagagccactaaggcttgaattctccacagagagg
ttcgtgaaaatacctgaggaggtcctagaacgttacttacaagtgggtaggccaacacca
ttggttagggcgaagagatttgaggagtatctaaatgcgccagttaagatatacctaaag
atggagggctatacgtacacgggtagtcataagataaactcggcacttgcctgggtatat
tatgcgcttaaggatggtgctaagttcgtgaccacggagacaggcgctggacagtggggt
tcagcggtggcgttagcagccgcgttatttaaggtcaaggcctacgtattcatggttaga
gccagctactacgccaagccactgaggaggtacttaatgcaaatgtacggtgccgacgtc
aatccaagcccaagtgacttaacggagttcggtaggaaattactacgtgaaaacccgaat
cacccaggcagcctgggtattgcaataactgagtctgctgaatatgcgttgaagaatggt
ggtaagtacgtggttggtagcgtaataaatgccgatataatgtttaagactattgcaggt
cttgaggccaagaagcagatggaattgattggtgaggatcccgacgtaatgattggcgta
gttggtggtggatctaattggggtggtgcattttattcattcattggagatgagttgagg
agtggtaaggttaggcgtaggtatatagcggttggagcattggaggtgcctaaagtaact
aagggtgtctataagtatgatgaccctgacacaggtagggtattacctcaattgaagatg
tataccattggtgcagatttcataccgccaccaatctacgcaggtggtttaagataccac
gccgtggcaccaacactatcttacctaatgagtaagggatacgttgagggtcgtgactat
gaccaagaggcggtctttaagatggcccagatatttgcccaagttgagggctatgtacct
gcaccggaaacagcccatgtattacctgttgttaaggagatagccgatgaggctaggagg
actggcgagaggaaggttattctgatcagtttctctgggcatggattgcttgatctgagc
aattacgcagatgtgcttggcttcgagaaggcatga

DBGET integrated database retrieval system