KEGG   Vulcanisaeta moutnovskia: VMUT_0682Help
Entry
VMUT_0682         CDS       T01440                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vmo01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:vmo00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:vmo00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(656646..657941)
Genome map
AA seq 431 aa AA seqDB search
MEKYRIDLPVDEIPTHWYNILADLPEPLSPPYDPDNGKRLELLKQVIPSEPLRLEFSTER
FVKIPEEVLERYLQVGRPTPLVRAKRFEEYLNAPVKIYLKMEGYTYTGSHKINSALAWVY
YALKDGAKFVTTETGAGQWGSAVALAAALFKVKAYVFMVRASYYAKPLRRYLMQMYGADV
NPSPSDLTEFGRKLLRENPNHPGSLGIAITESAEYALKNGGKYVVGSVINADIMFKTIAG
LEAKKQMELIGEDPDVMIGVVGGGSNWGGAFYSFIGDELRSGKVRRRYIAVGALEVPKVT
KGVYKYDDPDTGRVLPQLKMYTIGADFIPPPIYAGGLRYHAVAPTLSYLMSKGYVEGRDY
DQEAVFKMAQIFAQVEGYVPAPETAHVLPVVKEIADEARRTGERKVILISFSGHGLLDLS
NYADVLGFEKA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatagaatagaccttcccgtagatgaaatacccacgcactggtacaacata
ctcgcagacctaccagaaccactatcaccaccatacgacccagacaatggcaaaaggctt
gagctcctgaagcaagtaataccatcagagccactaaggcttgaattctccacagagagg
ttcgtgaaaatacctgaggaggtcctagaacgttacttacaagtgggtaggccaacacca
ttggttagggcgaagagatttgaggagtatctaaatgcgccagttaagatatacctaaag
atggagggctatacgtacacgggtagtcataagataaactcggcacttgcctgggtatat
tatgcgcttaaggatggtgctaagttcgtgaccacggagacaggcgctggacagtggggt
tcagcggtggcgttagcagccgcgttatttaaggtcaaggcctacgtattcatggttaga
gccagctactacgccaagccactgaggaggtacttaatgcaaatgtacggtgccgacgtc
aatccaagcccaagtgacttaacggagttcggtaggaaattactacgtgaaaacccgaat
cacccaggcagcctgggtattgcaataactgagtctgctgaatatgcgttgaagaatggt
ggtaagtacgtggttggtagcgtaataaatgccgatataatgtttaagactattgcaggt
cttgaggccaagaagcagatggaattgattggtgaggatcccgacgtaatgattggcgta
gttggtggtggatctaattggggtggtgcattttattcattcattggagatgagttgagg
agtggtaaggttaggcgtaggtatatagcggttggagcattggaggtgcctaaagtaact
aagggtgtctataagtatgatgaccctgacacaggtagggtattacctcaattgaagatg
tataccattggtgcagatttcataccgccaccaatctacgcaggtggtttaagataccac
gccgtggcaccaacactatcttacctaatgagtaagggatacgttgagggtcgtgactat
gaccaagaggcggtctttaagatggcccagatatttgcccaagttgagggctatgtacct
gcaccggaaacagcccatgtattacctgttgttaaggagatagccgatgaggctaggagg
actggcgagaggaaggttattctgatcagtttctctgggcatggattgcttgatctgagc
aattacgcagatgtgcttggcttcgagaaggcatga

DBGET integrated database retrieval system