KEGG   Vulcanisaeta moutnovskia: VMUT_0777Help
Entry
VMUT_0777         CDS       T01440                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VMUT_0777
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VMUT_0777
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VMUT_0777
Enzymes [BR:vmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VMUT_0777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
747949..749037
Genome map
AA seq 362 aa AA seqDB search
MKIEYRCSRCGYTIEATSWLWQCPKCGGPLDLVIEGLKFTLSEYRGLWRFSSVIPAKPLV
SLGEGFTPLVKADFLGKGSYLKLEYLNPTGSFKDRGSAVAISKALEFGAKAVVEDSSGNA
GISVAAYAATASIKARIYVPKDAPEGKKTLIRSLGAELIETSSRTEASRVAIKSVGPNEV
YIGHAWNPWFLQGTKTLAYELLNQIGHVPNAVILPVSAGTLLLGLWIGFNELLGFGLINK
VPRLYAVQTQGFADLYGRIHGEYSKEPTKFADALRVSNPPRLGQMVNAVTGSGGDALVIE
DDELLQAWKTLLKRGYIVEPSSAIALSGYMKLLSNNYIGSDDEVVIILTGSGLKYIDIMS
KV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagaatataggtgttcaagatgtggttacacgattgaggcgacttcatggctt
tggcaatgccctaaatgtggaggcccacttgatctagtaattgagggattaaagtttact
ttgagtgagtataggggtttatggagattctcaagtgtaatacctgcgaaacccctagtt
agtcttggtgagggattcacgccattagtcaaggctgatttccttggtaaaggcagttac
ctaaagcttgagtaccttaatccaactggttcgtttaaggatagaggatccgcggtggcc
atatcaaaggcactagagtttggtgctaaggctgtagttgaggattcaagtggtaatgca
ggtatatcagtagctgcctatgctgctacggccagtattaaggctagaatttacgtacct
aaggatgcacctgaaggtaagaagaccctcataagatcattgggcgctgaattaatagag
acctcctctaggactgaagccagtagggtggctattaagtccgtgggacctaacgaggtt
tatatcgggcatgcatggaacccctggttcttacagggtacgaagaccttggcttacgaa
ttacttaatcaaatagggcatgtacccaatgccgtaattctcccggtatcagctggtacg
ttgcttctcggactatggatcggcttcaatgagttactgggttttggtcttattaataaa
gtgccaaggctttatgccgttcaaacccagggatttgctgatctatatgggaggattcat
ggggagtattcgaaagagccaactaagtttgcggatgcacttagggtatctaatccgcca
aggcttggtcaaatggttaatgcggtcacgggtagtgggggtgatgcattggtgattgag
gatgatgaacttttacaagcgtggaaaacattgttaaagagaggatacatagttgagcct
agtagtgcaatagccctttcaggctacatgaaattattgagtaataattatataggtagt
gatgatgaggtcgtgattatactaaccggtagtggcttgaagtatatagatataatgagt
aaggtatag

DBGET integrated database retrieval system