KEGG   Vulcanisaeta moutnovskia: VMUT_0781Help
Entry
VMUT_0781         CDS       T01440                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vmo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(752562..753551)
Genome map
AA seq 329 aa AA seqDB search
MLTDFAMPRARLGRLWIGDGEPVRLVGVINASPESFFKGSVRKTINDAIKAAEFMISGGA
DIIDIGGMSTAPYNKTIISIDEEINRVVPIIKALKKEFPDLTVSIDTFRSRVAEAALDVG
ADVVNDVTGLKGDNDMAHVIADHGVSVIIMARERIVPAQGNDPVIRTIDALKESLDIALR
SGISEGNIVIDPGVGAWPPLSMDPLFTGGEPLRGEYIRGDNKYPWYSWDSIIIMSIGRIR
NEVGKPVLVGISRKSFLERLMRRNAPPEERLFASIAAETVAVIMGADAIRTHNAHESRDA
IKVAEALRSCLNKDPGICNEELIKIVKGK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
ttgctcacagactttgcaatgcctagggctaggcttggccgtttatggattggtgatggc
gaaccagttaggctagttggggttattaatgcaagtcctgaatccttctttaagggctcc
gtcaggaaaacaattaacgatgctattaaggccgcagaattcatgatatctggaggtgcc
gatattattgatattggcggtatgtccacggcgccgtataataagaccatcatcagcatt
gatgaggaaataaatagagtcgtacccataattaaggctttgaaaaaggagtttcctgac
ttgacggtgtctatcgatacatttagatcaagggttgctgaagcagcgttggatgtaggt
gccgatgtagtgaacgatgtcacgggattaaagggcgataatgatatggcacatgttata
gccgaccatggagtatccgttattatcatggccagagaacgtatcgttcctgcgcaaggt
aatgacccagtcattagaactatagatgcgttgaaggagagcttagatattgcattacgt
agtggcattagtgagggtaatattgttattgatccaggcgttggtgcatggcctccatta
agtatggatccattatttacaggtggtgaaccgttgaggggtgagtatattcgtggtgat
aataagtatccgtggtattcctgggattcaataattataatgagcataggcaggataagg
aatgaagtaggtaagccggtacttgttggtatttccaggaagtcatttcttgagagatta
atgcgtaggaatgcaccgcctgaggagagactattcgcatcaattgctgcggagactgtt
gcagtaatcatgggtgcggatgccattaggactcataatgcccatgagagtagggatgcc
attaaagttgctgaagcccttagatcatgccttaataaggaccctggtatatgtaatgag
gagcttatcaagattgttaaaggtaagtaa

DBGET integrated database retrieval system