KEGG   Vulcanisaeta moutnovskia: VMUT_0799Help
Entry
VMUT_0799         CDS       T01440                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
vmo  Vulcanisaeta moutnovskia
Brite
Enzymes [BR:vmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     VMUT_0799
Transfer RNA biogenesis [BR:vmo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    VMUT_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(768167..769693)
Genome map
AA seq 508 aa AA seqDB search
MNSLSNALLNRLKPTRTISGVVPIAIMVEPVACPFNCIYCPGGKKTNTPKSYLPDSPVVL
RAAPLNYDPYKQVVARIRQYEALHHPVSKVELIIMGGTVTSLPESYLEWFVGNAFKAVND
YPFIGTESIDNTSIEYEHKRNEKARIRVVALELETRPDFVKPKHIDIMLRLGFTRVEIGV
QSIYDDVLKRVKRGHGVKEVIEATQYLKDSAYKVCYHIMPGLPGSTPDRDLEMVKTIFSD
PSFMPDCIKVYPTFVVKDTELYEEWLKGLYRSYDEETWHWLLARIMASIPRWVRVMRFGR
DIPLHWVVDGPKIGNMREVVLKDMEELGLNCVEIRCREVGHKYIKKGLVPTPRRLMINRI
DYEASSGHEVFLEATDDEDTLYGILRLRIPSANAHRPEIKVGRTALIRELHVYGPELPIG
SKTTDLFWWQHRGIGRALMARAEHITLEEFNAYRMLVISGVGVREYYRMLGYRKYPGSFY
MFKDLRKSILTEPNLNDQSSSNESLIMG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcctaagtaatgcattacttaatagattaaagcccactaggacgatatctggg
gtagttccaattgccataatggttgagcccgtggcatgcccattcaattgcatatactgc
ccaggtggaaaaaagacaaacacgccaaagagttacctcccggactcgcctgtggtatta
cgggcagcaccattgaattacgatccatacaagcaggtggtggctaggataaggcaatac
gaagctcttcatcatccagtatctaaggttgagctaataataatgggcggcacagtgacc
tcactgcctgagtcataccttgagtggtttgttggcaatgcattcaaggctgttaatgat
tatccattcataggcacggaatccattgataataccagtattgagtatgaacataaacgc
aatgagaaggcaagaattagagttgtagctctcgaactagagactaggccggacttcgtg
aagcctaagcacatagatattatgctgagactcggctttactagggttgagattggtgtt
cagtctatatacgatgatgtacttaagagagttaagaggggtcatggtgttaaggaagtc
attgaagcgacccagtatctaaaggactctgcctataaggtctgctaccacataatgcca
gggctccctggatcaacaccagatagggatctcgagatggtaaagacaatattcagtgac
ccaagcttcatgcccgactgcattaaggtttacccaacctttgtggtaaaggacaccgag
ttatacgaggagtggttaaagggcctttataggagttatgatgaggagacttggcactgg
ctcctggcccgtatcatggcttcaatacccagatgggtcagggttatgaggtttggtagg
gacataccacttcactgggttgttgatgggccaaaaataggtaatatgagagaagtagtg
cttaaggatatggaggaactaggccttaattgtgtggagattaggtgccgtgaggttggt
cataagtacataaagaagggcctagtaccaacaccgaggagactaatgattaataggatt
gattatgaggcatcgagtggtcatgaggtgttcctagaggctactgatgatgaggacacg
ctctacggaatactgaggcttaggataccaagtgctaatgcgcataggcctgagataaag
gttgggaggactgcattgattagggaattacatgtttatggtcctgaactaccaattggt
agtaagaccactgatttgttttggtggcaacatcgtggtattggtagggcattgatggcg
agggctgagcacataactcttgaggagtttaatgcctataggatgctcgttatatcaggt
gtcggcgttagggagtactatagaatgcttggttataggaagtatccagggagtttctat
atgtttaaggaccttagaaagtcaatattgacagaacccaacctgaatgatcaatcttca
agtaatgagagtttaataatgggttaa

DBGET integrated database retrieval system