KEGG   Vulcanisaeta moutnovskia: VMUT_0922Help
Entry
VMUT_0922         CDS       T01440                                 

Definition
tungsten-dependent formaldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vmo01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:vmo00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
880831..882669
Genome map
AA seq 612 aa AA seqDB search
MFGWGGHILRIDLSRRRYVVQSLDPSLAQNYIGGRGFAIKTLWDELPPGIDPLSPLNKLI
LAVGPLTALPIPNSGKLLVAAKSPLTGGYGDGNIGSWLAVHMRRADLDMIIIEGRAEKPT
YLYIENKGEEFRVDFNNADDLWGLDSFTTEDRLKKVHGSDVGMVLIGPAGERLVRFATIV
AQKGRSGGRPGIGAVMGSKNLKAVVMRGHGDIKVADPMLRKIGVDAIVATKSKPGYPFWM
RQGTTSTVEWAQEASVLPTYNYSEGQFDDYEKIGGFSVEKNKITTKSCPQCVMACGHVVK
DAENEPAELDYENIAMLGSNLGIGDLAKVAHLNRIADMMGMDTISLGSSLGFAMEASEKG
LLKEGIEWGDYKRAVDVAMDIALQRTELGRLLGKGVRAASMELGQEATEFAMHVKGLEIS
AYDCHAAPGMALAFSTSPIGAHHKDAWLISWEVQRGRFDYTKDKVEKLVEMQNIRGGLFE
TIVTCRFPWVEVGLELDWYFRLFKAATGMDMNMDILSTINNRIYTLIRAFWVREYGHWDR
AYDTPPVKWFKRPLSRGPLKGAKLDYDGYQRMLSWYYELRGWDERGIPRKDTLRRLDLDF
VISQLGSKVNLN
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtttggatggggtgggcatatattaaggattgatctttccagaaggaggtatgttgtt
caatcactagatccatcccttgcacagaactatattggtggtaggggctttgcaataaag
actttatgggatgaattgccgccaggaatcgacccattaagtccacttaataagttaata
cttgccgtggggccattgacggcattaccaatacccaatagtggtaagttactcgtggct
gctaaaagcccattaacgggtggttatggtgatggtaatattggttcatggttagcagtt
catatgaggagggcggaccttgatatgataataattgagggtagggctgagaaacccacg
tatctatacattgagaataagggcgaggagttcagggttgattttaataacgcagatgat
ttatggggccttgactcatttaccactgaggataggttaaagaaggttcatggtagtgac
gtgggcatggttctcataggccccgctggtgagaggctcgtgagattcgcaactatcgtt
gcccagaagggacgtagtggtggtagacctggcataggcgctgttatgggtagtaaaaac
ttgaaggcagtggttatgaggggccatggcgacattaaggttgcagatccaatgcttagg
aagattggcgtcgatgccatagtggccacgaaatctaaaccaggttatccattctggatg
aggcaaggaaccacatcaacggtagagtgggctcaagaagctagtgtgttgcccacgtat
aattattccgagggtcaatttgatgattatgaaaaaataggtggtttttctgttgagaaa
aataagatcacgactaaatcatgtccgcaatgcgtcatggcttgcgggcacgtggttaag
gacgctgaaaacgaacctgctgagttggattatgagaatatcgcaatgctcggtagtaac
cttggtattggtgatttagctaaggtggcgcacctaaataggatcgcggatatgatgggt
atggacacgataagcctcggttcaagcctaggttttgcaatggaggcttcagagaagggg
cttcttaaggagggaattgagtggggtgattataagagagctgttgatgttgccatggat
atagcactacaaagaaccgagctgggtaggttacttggtaagggtgttagggcagcgtcg
atggagctgggtcaggaagccactgaatttgcaatgcatgttaagggtcttgaaataagt
gcctatgactgtcacgcagcgccaggtatggcattagcattttctacaagcccaattggt
gctcatcataaggatgcctggctaatatcctgggaggttcagaggggtaggtttgactat
accaaggataaggtcgagaagcttgtggaaatgcagaacataaggggtggtctattcgaa
acaatagtgacctgcaggttcccctgggtcgaggtcggcctcgaacttgattggtacttt
aggttgtttaaggctgccacggggatggacatgaacatggatatactaagtactataaat
aataggatttatacattaatcagggcgttttgggttagggagtatggacattgggatagg
gcgtatgacacaccacctgtcaagtggttcaagagaccattgagtaggggcccactcaag
ggtgctaagcttgattatgatggttatcagagaatgctcagttggtattacgagttgagg
ggttgggatgagagaggtataccgagaaaggataccttaaggcgtttagatcttgatttt
gtgatttcgcaacttggatctaaggttaaccttaattga

DBGET integrated database retrieval system