KEGG   Vulcanisaeta moutnovskia: VMUT_0979Help
Entry
VMUT_0979         CDS       T01440                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vmo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(942722..943831)
Genome map
AA seq 369 aa AA seqDB search
MGSQEFIDLLKRLSEAFGPSGFEDEVRDLVIKELGPYVDDLIVDKWGNVIGVRYGRRRDL
KAMVAAHIDEIGLLIDNIDKNGFLRFRAIGGWNEVTLVSQRVVIKTVDGRKIKGVIGSRP
PHVTPPGKEREAPELKDLFIDIGASSDEEVRKLGIKVGSVAILDRDFEVLNENVVTGKAF
DDRVGVAVMLWAARQLRDSEATIYFVATVQEEVGLRGAQIAADRVYPDFAIALDTTIAAD
VPGVTEREFVTRIGKGPAVKVMDGGRGSVFIAHPTLTNFLISVAEELKIPYQLEVLIGGT
TDALGIAFRRDGIPATTISIPTRYVHSPVELLSIDDAINAAKLLSEALSRVDEKLAQKLR
EKTIKVASK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggggtcacaggaattcatagacttactcaaaaggttgagtgaggcattcgggccatca
ggctttgaggatgaggttagggatctggtcattaaggagttggggccttatgtcgatgat
ttaatagttgataagtggggtaatgtaattggtgttcgatacggcaggagaagggaccta
aaggccatggttgccgcccacattgatgaaattggcctattgattgataatatcgataag
aatggtttcctgagatttagggccattggtggttggaatgaggtgaccttagttagtcag
agggttgttattaagaccgttgatggtaggaagattaagggtgtaattggtagtaggcca
cctcacgttacaccacctggtaaggagagagaggcccctgagcttaaggacttattcata
gatattggggcatcaagtgatgaggaggttaggaagttgggtattaaggttggttcggtg
gctatccttgatagggactttgaggttcttaatgagaatgtggtcactggtaaggcgttt
gacgatagggttggcgtggccgtaatgctttgggccgctagacagctgagggatagtgag
gctactatctacttcgtggctacggtgcaggaggaagttggtctcaggggcgcccaaatt
gcggctgatagggtatatccagatttcgcgattgctctggataccacgattgcggctgat
gtgcctggcgtcactgagcgtgagttcgtgactaggattggcaagggaccggccgttaag
gttatggatggcggtagaggcagcgtcttcattgctcacccaacactaacgaatttccta
atatcggttgctgaggagctgaagataccataccaattagaggtgttgattggtggtacg
actgatgcattgggaattgcctttaggagggatggtataccggcaactacgatatcaata
cccaccaggtatgttcatagtcctgtggagttattaagtattgatgatgcaattaatgcg
gctaaactactcagtgaagcattatcgagagttgacgagaagcttgctcaaaaacttagg
gagaagactattaaggttgcatcgaagtaa

DBGET integrated database retrieval system