KEGG   Vulcanisaeta moutnovskia: VMUT_1171Help
Entry
VMUT_1171         CDS       T01440                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VMUT_1171
Enzymes [BR:vmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     VMUT_1171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1145077..1146021)
Genome map
AA seq 314 aa AA seqDB search
MDALKSPRFAQPITFARLPLVRDLKGNGVLGAFVGVPFDGGATFYTGARLGPQFIRAESR
LLRPYNMDLDVYPFIALRAVDYGDVDVIPTSVVRTLDRIEETIGSVIDQGATPFIAGGDH
SITLGVLRAVGRRFKPLVLHFDSHFDYWDEYWGEKYTHGTWVRRAIEEGLIRGVIQVGIR
GPQYDKSDLEYPRNSPVPIRVITMSEVDAKGINWLINELRNSLSGSVYVSFDIDSVDPAY
APGTGTREPGGFTSREALLIIRSLANINFELVGFDVVEVSPPLDTANITSLLAANITYQA
MSIKARQVNKIAKG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttggatgctcttaagtctccccgttttgctcagcccataacgtttgcaagacttccactc
gttagagatctaaagggtaatggtgttcttggtgccttcgttggtgtgccatttgatggt
ggtgcaacattctatactggggctaggcttggtcctcaattcattagggctgagtctagg
ttgttgaggccgtacaacatggacctcgatgtttacccctttatcgcccttagggctgtg
gattatggagatgttgatgttatacccaccagcgttgttaggactttggataggattgag
gagaccataggcagtgtgattgatcagggtgcaacaccattcattgccggtggtgatcat
agtataacactcggtgttcttagggctgtgggtaggaggttcaagccgctcgtcctacac
ttcgatagccactttgattattgggatgaatattggggtgagaagtatacccacggtacg
tgggttaggagagccattgaggagggtctaattaggggtgttattcaggttggtattagg
ggtcctcagtatgacaagtctgatcttgagtacccgaggaattcaccagtgcctattagg
gttataacgatgagtgaggttgatgccaagggtatcaactggttgattaatgagttgagg
aattcattaagtggtagtgtctatgtttcctttgacatagactccgtagacccagcctac
gcaccaggtactggaactagggagccaggtggtttcacaagtagagaggccctgttgata
attaggtcgttagccaacattaatttcgagcttgttggttttgacgttgttgaggtatca
ccaccacttgatacggcaaacataacgagcctactggccgcaaacataacataccaagca
atgtcaataaaggcaagacaagtgaataaaatagcaaaaggttag

DBGET integrated database retrieval system