KEGG   Vulcanisaeta moutnovskia: VMUT_1198Help
Entry
VMUT_1198         CDS       T01440                                 

Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase (POR), subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
vmo00010  Glycolysis / Gluconeogenesis
vmo00020  Citrate cycle (TCA cycle)
vmo00620  Pyruvate metabolism
vmo00633  Nitrotoluene degradation
vmo00640  Propanoate metabolism
vmo00650  Butanoate metabolism
vmo00680  Methane metabolism
vmo00720  Carbon fixation pathways in prokaryotes
vmo01100  Metabolic pathways
vmo01120  Microbial metabolism in diverse environments
vmo01130  Biosynthesis of antibiotics
vmo01200  Carbon metabolism
Module
vmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VMUT_1198
   00020 Citrate cycle (TCA cycle)
    VMUT_1198
   00620 Pyruvate metabolism
    VMUT_1198
   00640 Propanoate metabolism
    VMUT_1198
   00650 Butanoate metabolism
    VMUT_1198
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    VMUT_1198
   00680 Methane metabolism
    VMUT_1198
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    VMUT_1198
Enzymes [BR:vmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     VMUT_1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ADY01403
UniProt: F0QYH0
Position
1174218..1175465
Genome map
AA seq 415 aa AA seqDB search
MSVSALESKRLDAVLKGDEEVEVVGTGTDAVAYALMLADIDVTSAYPIRPYGGVMQTVAR
LIADGYMKAEYIVAAHEHDQFEIVKHASAVGARTFVGSSGVGWLLAIEAIVAISTDRYPV
VALIGNRALDDPGAYGVEHNDALMVRDVGWLLTWVDTAQEALDTTLIAYRVAEDPSVMLP
VGISMDGAFLTHSEHAFKIPPKSKVQKFLPPYDLGNRKLHPSNVISVAPQVNEDWVTELR
KQMDEAMKNARKVIEEAYRDFAKIFGRDYGNPFIETYMVEDADVVMVGMGTVSKPIKEAV
RRLRAKGEKVGFLRIRWFRPFPTEDIIRYLSGVKVVAVVDRDYSFGSPFDGGAVFTEIRS
ALYEAEHRPLMMNFIGGLGGREITYNDAINMFNMALNAARKGKVEQRVIWYGVRE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtttcagcacttgaatctaaacgtcttgatgcagtgcttaagggagatgaggag
gtagaggttgttggtactggcactgatgcggtggcctacgcactaatgcttgctgatatt
gatgtaacatcggcatacccaataaggccttacggcggtgtcatgcagacggtggctagg
ttaatagctgatggttatatgaaggccgagtacatagtggctgcccatgaacatgaccag
ttcgagatcgttaagcacgcatctgccgttggcgcaaggacttttgttggcagtagtggt
gttggttggttactggctattgaggccatagtggccattagcacggataggtacccagtg
gtcgcattaataggtaatagggcgcttgatgatccaggagcatatggtgtagagcataat
gatgcattgatggttagggacgtaggctggttattgacatgggttgacaccgcccaggag
gctctggacaccacattaatagcctatagggttgctgaggatccaagtgtcatgcttcca
gtgggtatatcaatggatggcgcattcctaacgcatagcgagcatgcatttaagataccg
cctaagtctaaggtccagaagttcctaccaccctacgatttgggcaacaggaagttacac
ccaagcaacgtgatcagtgtggcaccacaggtcaatgaggactgggttacagagcttagg
aagcagatggatgaggccatgaagaatgcgaggaaggttattgaggaggcctatagggac
ttcgcgaagatcttcggtagggattatggtaacccatttattgagacttatatggttgag
gatgccgacgtggtcatggttggtatgggcactgtttctaaaccaattaaggaggctgtg
aggagattgagggccaagggtgagaaggttggctttctcaggattaggtggtttagacca
ttcccaaccgaggacatcatacgttacctgagtggtgttaaggttgtggctgttgtggat
agggattactcatttggttcgccttttgatggtggtgcagtatttactgaaataaggagt
gcgttgtatgaggcggagcataggccattaatgatgaatttcattggtggacttggcggt
agggagattacctataatgatgcgattaatatgttcaatatggctttgaatgcagctaga
aaaggtaaggttgagcagagggtgatttggtatggggttagagagtaa

DBGET integrated database retrieval system