KEGG   Vulcanisaeta moutnovskia: VMUT_1242Help
Entry
VMUT_1242         CDS       T01440                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VMUT_1242
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VMUT_1242
Enzymes [BR:vmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     VMUT_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1219680..1221500
Genome map
AA seq 606 aa AA seqDB search
MALFGWVGKVLYIDLSNDKVWIENVDPEIYDKVLGGEGFAAYVIYKRLREIKGPLNPSNV
LVFASGPLTSDLIPQSGRVSVGFISPLTGIWGSAHIGTRFAYEMKRAGFDAIVVLGRAER
HVYVYVKDDIADIRDASKYWGLDIIETVHALRRDLNDQSIRVLAIGPAGEHLVKFSTIAN
EEGIGGRAGGGAVMGSKNLKAIVVKGTKPIEFAYPEELRKYVRDLNARLGSSARGVSLRK
FGSAGSVGIYNEIGNIPVRNFAWGRWDDNEVFKITGETMAKTILERPYPCTTCPVACKRF
VRVKPGKWFDKEFRGLGPEYETISLFGTNLLLSDLEAIARMNEDCDRLGLDTISTGNVIG
FIFEAAERGLISKEIEGLRLEWGNADTVIKLIRKIAYREGIGDLLAEGVRRVSEKIGGQD
FAVHVKGLEMPAHDGRAFFAHALSFVTINRGADHLGWPHMPWRGIAVPELGIDARNDRYS
ESEEVVDIVIKMQNLMTIYDSLVMCKYAFTAGLTVTDIVNLLKYTTGKEYTVNKLMEMGD
RIWKIERWIDNQLGVTNKDDKLPRRMLTPHANRNDTKVPYIVEKWLPIYYRKRGLTEDGI
VKELDV
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcactcttcggttgggttggtaaggtgttatatattgatttaagtaatgataaggtg
tggattgaaaatgttgatcccgagatttatgataaggtacttggtggcgaaggttttgct
gcctacgtgatttataagaggttgagggaaataaagggtccgcttaatccgtcaaatgtg
ttggtatttgcgagtggtcctttgaccagtgatttgattccgcagagcggtagggtttct
gttggtttcatatcgccgttgacaggcatatggggctctgcgcacataggtactaggttt
gcatatgagatgaagagggctggctttgatgcgattgttgtacttggcagggctgagaga
catgtttatgtttatgttaaggatgacattgcggacattagggatgccagtaagtactgg
ggtttagatattattgagaccgttcatgcattaaggagagaccttaatgaccaatcaatt
agagtattagctatagggcctgcgggggagcacttagttaagttttcaacaatagctaat
gaggaaggtattggcggtagggcaggtggtggtgctgtcatgggtagtaagaacctaaag
gcaatagtagtgaagggtacaaagccaatagagtttgcctacccagaggagttgaggaaa
tacgttagggatctaaacgcaaggcttggtagttccgccagaggtgtgtcgcttaggaag
tttggtagtgctgggagcgttgggatctataacgaaatcggcaacataccagtgaggaac
tttgcctggggtaggtgggatgataatgaagtattcaaaataactggcgagaccatggca
aagacaatactcgagagaccatacccatgcaccacatgcccagtggcctgcaagagattc
gtcagggtaaagccaggaaagtggttcgataaggaatttaggggtttagggcctgagtac
gagacaatatcactattcggtacaaacctactactcagtgatttggaggccatagcgagg
atgaatgaggattgcgatagacttggtctcgacacaatatccacgggcaatgtcataggc
ttcatatttgaggctgcagaaaggggattaataagtaaggagattgagggtttaaggctc
gagtggggtaatgcggatactgtaattaagctaatacgaaaaatagcgtatagggagggt
atcggtgatttattggctgagggtgttagaagggtttcggagaagattggtgggcaggac
tttgcagttcatgttaagggtcttgagatgcctgcccatgatggtagggcattcttcgcc
catgctctcagcttcgtgacaataaatagaggcgctgatcaccttggatggcctcacatg
ccctggagaggaatcgcagtacccgaacttggtattgatgctcgtaatgataggtacagt
gaatctgaggaggtcgtagatatagtaatcaagatgcagaacttaatgacaatatacgac
tcactcgttatgtgcaaatatgcctttacggcaggactaaccgtaaccgacatagtaaat
ctactgaaatacacaaccggcaaggaatacacagttaataagttaatggaaatgggggat
agaatatggaaaatagagaggtggatagataatcaactaggagtaacgaacaaagacgat
aaattaccaaggagaatgctaacaccgcacgccaatagaaatgatacaaaagtaccatat
atagtcgagaagtggttaccaatatactacagaaagaggggtttaacagaagatggcatt
gttaaggaactagacgtataa

DBGET integrated database retrieval system