KEGG   Vulcanisaeta moutnovskia: VMUT_1264Help
Entry
VMUT_1264         CDS       T01440                                 

Definition
pyrophosphate-dependent phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VMUT_1264
   01230 Biosynthesis of amino acids
    VMUT_1264
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VMUT_1264
   00030 Pentose phosphate pathway
    VMUT_1264
   00051 Fructose and mannose metabolism
    VMUT_1264
   00052 Galactose metabolism
    VMUT_1264
  Energy metabolism
   00680 Methane metabolism
    VMUT_1264
Enzymes [BR:vmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VMUT_1264
Protein phosphatases and associated proteins [BR:vmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VMUT_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1244334..1245338
Genome map
AA seq 334 aa AA seqDB search
MRIGILTGGGDAPGLNIAVYTLTKLLERKHEVYAIFHGWRGILDKEVRRVTSKDLIDFAF
TGGTFIRTSRTNPFKDEARVETFARNLKELGLDVIVAIGGDDTLSAAAQTQARGLANVVG
IPKTIDNDVYGTDYTIGFDTAVNEAIRVTESFKTTLISHERIGIVEVMGREAGWIALFTG
LATMADFVLIPERPVNWDVVANRVKEVYRDRGWALVVVSEGIKEYGGPRDEFGHSRLGGV
GNELAQYIEKVTGLETRAVVPGHIIRGVAPTAFDRVLAVRFATETHSLIENGDFSKMVAY
RNGDIVNIPITEILGKNRLVSGYWMRLYEIYWGL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgagaattggcatacttactggtggaggtgatgctccagggcttaacatagccgtatat
acactgactaaattattggagaggaagcatgaggtttatgcaatattccatggctggagg
ggaatactggataaggaggttaggagggtcacgtctaaggacctaatagacttcgcattc
acaggtggtacattcattaggacatcgagaacaaatccatttaaggatgaggctagggtt
gagacctttgccaggaatcttaaggagcttggtttggatgttattgtggccattggtggt
gacgataccctgagcgccgctgcgcagacccaggcgaggggtttggctaatgtcgttggt
attccaaagactattgataatgacgtatatggtactgactatactattggctttgatact
gcggttaatgaggccatcagagtaacggagtcctttaagactacgttgatctctcatgag
aggattggtattgttgaggtcatgggcagggaagctggctggatagccctattcactgga
ttggctacgatggctgatttcgtcctcatacccgagagacctgttaactgggatgtcgtg
gctaatagggttaaggaggtgtatagggatagggggtgggccttggttgttgtttctgag
ggtattaaggagtacggtggacctagggatgagttcgggcattcgaggcttggtggcgtt
ggtaatgaattagctcaatatattgagaaagttactggccttgaaactagagccgtggtt
ccggggcatataattaggggtgtagctccaacggcatttgatagggtattagccgttaga
ttcgccacggagacccacagtttaattgaaaatggtgatttcagtaaaatggttgcctat
aggaacggtgatatagtcaatatacccataacagagatcttaggcaagaataggctagtg
agtggttattggatgagactgtacgaaatatattggggactctaa

DBGET integrated database retrieval system