KEGG   Vulcanisaeta moutnovskia: VMUT_1264Help
Entry
VMUT_1264         CDS       T01440                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
vmo00010  Glycolysis / Gluconeogenesis
vmo00030  Pentose phosphate pathway
vmo00051  Fructose and mannose metabolism
vmo00052  Galactose metabolism
vmo00680  Methane metabolism
vmo01100  Metabolic pathways
vmo01110  Biosynthesis of secondary metabolites
vmo01120  Microbial metabolism in diverse environments
vmo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VMUT_1264
   00030 Pentose phosphate pathway
    VMUT_1264
   00051 Fructose and mannose metabolism
    VMUT_1264
   00052 Galactose metabolism
    VMUT_1264
  Energy metabolism
   00680 Methane metabolism
    VMUT_1264
Enzymes [BR:vmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VMUT_1264
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     VMUT_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase Bmp
Motif
Other DBs
NCBI-ProteinID: ADY01469
UniProt: F0QYN6
Position
1244334..1245338
Genome map
AA seq 334 aa AA seqDB search
MRIGILTGGGDAPGLNIAVYTLTKLLERKHEVYAIFHGWRGILDKEVRRVTSKDLIDFAF
TGGTFIRTSRTNPFKDEARVETFARNLKELGLDVIVAIGGDDTLSAAAQTQARGLANVVG
IPKTIDNDVYGTDYTIGFDTAVNEAIRVTESFKTTLISHERIGIVEVMGREAGWIALFTG
LATMADFVLIPERPVNWDVVANRVKEVYRDRGWALVVVSEGIKEYGGPRDEFGHSRLGGV
GNELAQYIEKVTGLETRAVVPGHIIRGVAPTAFDRVLAVRFATETHSLIENGDFSKMVAY
RNGDIVNIPITEILGKNRLVSGYWMRLYEIYWGL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgagaattggcatacttactggtggaggtgatgctccagggcttaacatagccgtatat
acactgactaaattattggagaggaagcatgaggtttatgcaatattccatggctggagg
ggaatactggataaggaggttaggagggtcacgtctaaggacctaatagacttcgcattc
acaggtggtacattcattaggacatcgagaacaaatccatttaaggatgaggctagggtt
gagacctttgccaggaatcttaaggagcttggtttggatgttattgtggccattggtggt
gacgataccctgagcgccgctgcgcagacccaggcgaggggtttggctaatgtcgttggt
attccaaagactattgataatgacgtatatggtactgactatactattggctttgatact
gcggttaatgaggccatcagagtaacggagtcctttaagactacgttgatctctcatgag
aggattggtattgttgaggtcatgggcagggaagctggctggatagccctattcactgga
ttggctacgatggctgatttcgtcctcatacccgagagacctgttaactgggatgtcgtg
gctaatagggttaaggaggtgtatagggatagggggtgggccttggttgttgtttctgag
ggtattaaggagtacggtggacctagggatgagttcgggcattcgaggcttggtggcgtt
ggtaatgaattagctcaatatattgagaaagttactggccttgaaactagagccgtggtt
ccggggcatataattaggggtgtagctccaacggcatttgatagggtattagccgttaga
ttcgccacggagacccacagtttaattgaaaatggtgatttcagtaaaatggttgcctat
aggaacggtgatatagtcaatatacccataacagagatcttaggcaagaataggctagtg
agtggttattggatgagactgtacgaaatatattggggactctaa

DBGET integrated database retrieval system