KEGG   Vulcanisaeta moutnovskia: VMUT_1281Help
Entry
VMUT_1281         CDS       T01440                                 

Definition
acyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VMUT_1281
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VMUT_1281
   00620 Pyruvate metabolism
    VMUT_1281
   00640 Propanoate metabolism
    VMUT_1281
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    VMUT_1281
   00680 Methane metabolism
    VMUT_1281
Enzymes [BR:vmo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     VMUT_1281
Lipid biosynthesis proteins [BR:vmo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   VMUT_1281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258686..1260578
Genome map
AA seq 630 aa AA seqDB search
MAVNQKFYSLDRIRRIAIEAAENPAKFWADKVDYLTWFERPKSILEGKAPDVYWFRGGYL
NISYNAVDRHIPARANRVAFYYENERGDSKVISYWDLYREVNRAAYLLKELGVRRGDTVS
MMMPSIPEAVYFGLAVHRLGATLVIHYAGLSEETLAYRLQDCGSKIFVVASKGFRAGEEV
RMKDLIDRTLEKYQTPVEKVLVVSRGFSDFNIKQGRDIVYEDAAPKGKVYVEPTPVEANE
PATIYYTSGTTGRPKGLWQSNGGYPIGLNWTFRALFNPQDVDVWWTISELGWPVWPMANL
YTAPVMGLTSLLFEGFIGYKRDLFARIIEKYHVSLIWSSTTTLYTIRSIGEEALKGDLSS
LRIILNTGETLNPSVAEWYIQQLPSTIIADAYWMTEHLIPIAATPYGLGEIPFKPGSTGI
QFPGSKWLVVDDDGNPLPPGQRGYIVIAIPNPAMAKMWNDPNYERLIKTYWSRFSGYFYT
GDYGFYDTDGYLYVLGRADDILSIAGERLGTMDIEGILARHRAVAEAAVVGVPAPGGGEK
VLAFVVLKSGEIPSETLVNDIKEFARASGTRVDDVVIVRRLPKTKSGKIMRRLLRALVRN
EPYGDVSTLDDIRTLDDIKAALMERGYIKP
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcagttaatcaaaagttctattccttagataggattaggcgaattgctattgaggcc
gctgaaaatccagctaagttctgggctgataaggttgattatttaacgtggtttgagaga
ccgaagtcaatacttgaaggtaaggcgcccgatgtttattggtttaggggtggttaccta
aatattagttataatgcagttgataggcatataccagctagggctaatagggttgctttt
tactatgagaatgagagaggcgatagtaaggtcattagttattgggatctttatagggag
gtaaatagggctgcctatttacttaaggagcttggcgttaggaggggggatacagtatcc
atgatgatgccgagcataccggaggctgtttacttcggtcttgccgtacatagacttggc
gctaccctcgtgattcactatgcaggtttaagcgaggagacacttgcatataggcttcag
gattgtgggtcaaagattttcgtggttgcatcaaagggatttagggctggtgaggaggtc
aggatgaaggacttaattgataggacactcgaaaagtatcagacacctgtggagaaggta
ctcgtagtctccagaggtttttctgactttaatattaagcagggtagggatattgtgtat
gaggatgcggctcccaagggcaaggtctatgttgaacccacaccggtggaggcgaatgaa
ccagccacgatatactatacatcaggtacgacgggaagacctaagggcttatggcaaagt
aatggtggttacccaataggccttaattggacatttagggcgttatttaatccgcaagat
gtagatgtttggtggacaataagcgaactaggttggcctgtgtggcctatggctaattta
tataccgcacccgtgatgggattaacgagccttttattcgagggatttattggctataag
agggatttattcgctaggattattgagaagtaccacgtctcactgatttggagtagtaca
actacactttacacaattaggagtattggtgaggaggcccttaagggagatttatcgagc
ctaaggataatactcaacactggcgagactctcaatccaagtgttgctgagtggtatatt
cagcaattaccgagcacaataattgcagatgcctattggatgactgagcacttaatacca
atagccgcaacaccctatggccttggtgaaataccgtttaaacctggttcgacgggtatt
caattcccaggtagtaagtggcttgtggttgatgatgatggtaacccactaccacctgga
cagaggggttacatagtcattgctattccaaacccagcaatggctaagatgtggaatgac
cccaattatgagagattaataaagacgtattggtccaggttctctggttacttctataca
ggtgattatggattttacgacaccgacggctatctatacgtacttggcagggcagatgac
atactaagcattgctggtgaaagacttggtacaatggacatagagggcatcctcgcaagg
cacagggcagttgccgaagcggcagttgtaggtgttccagcacctggcggtggtgaaaag
gtcctggcttttgtcgtactaaagtctggggagataccatctgagaccttggttaatgat
attaaggagttcgcaagggcgtcagggactagggtggatgatgtagtaatagtaaggaga
ttaccaaagactaagtccgggaagataatgaggaggttattgagggcattggtgaggaat
gaaccgtatggcgatgtatcaacactggatgatattaggacattagatgatataaaggct
gccttaatggagcgtggttacataaagccgtga

DBGET integrated database retrieval system