KEGG   Vulcanisaeta moutnovskia: VMUT_1361Help
Entry
VMUT_1361         CDS       T01440                                 

Definition
carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vmo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1341949..1343355)
Genome map
AA seq 468 aa AA seqDB search
MSLGVIDVGTTNIKLIIYDDELNQRYSETVNVPMLFPANYYVEQDANALRLAFNHLINTA
RDKGVKYIGISTYRASIIAWDKSGNPLINIITWLDRRGLEIVNKFPYSFMRHLPLMSSIL
IPTSPVTQVLWLLRNRQDLIERARKGEVFIGTLSSYLAYLVSNRYVNDAGNEALTGLWHP
GNLSSIDLIYDLLKIPREVSPEVVDNVHEFGEANGMTVGVLIADQQAAMVGEGCLSVGCG
KVTNGTGSFVDAVIDRFRLVGGGLLPLLILKYGGSVFYGVEGFLPATGSVIDWLVKLGLL
SSPQELDGLTNVSTQDIVVIPALAGVNVPPRPCARGLIDGLTLNTTREAFVRAVVEGVVQ
LIGLIFDKIKNYSRVDVVRVDGGLSRSALFLRLLATALGTVVERQRDVEATARGVAALLK
VFRGDWSLNDIIRGIHVNVELRIKPGEERLSLNRDVVKRIVEGMRCRA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttggggtcattgatgttgggaccacaaacattaagctcataatatatgatgat
gagcttaaccagaggtattccgagactgtaaacgtgccaatgctattccccgccaattac
tacgttgagcaggacgcaaacgcgcttaggttagctttcaatcacttaattaatacggct
agggataagggtgttaagtacatcggtatttcgacatatagggcatcaataatcgcctgg
gacaagtcgggtaatcccctcattaatataatcacgtggttagacaggagaggtctggag
attgttaataaattcccatactcattcatgagacatttgccactaatgagcagtatccta
ataccgacatcacccgttacccaagtactctggttgttgaggaataggcaggatttaatt
gaacgtgcaaggaagggtgaagtattcattggtacattgagttcatacctggcgtatctc
gttagtaataggtatgttaatgatgccggtaatgaggcattaacgggactttggcatcca
ggtaatttaagtagtattgacctaatttatgatttactgaaaatacctagggaggtaagt
cctgaggttgttgataatgttcatgagtttggggaggccaacggaatgaccgttggggtt
ttaatagcagaccagcaagcagcaatggttggtgagggctgcctaagcgttggttgtggt
aaggttacgaatggtacaggttccttcgttgacgccgttattgataggtttagacttgtt
ggtggtggtttattaccgctcctcatacttaagtatggaggtagtgtgttttatggagtt
gagggtttcctgccagcgaccggttcggtaattgactggctagttaagcttggactgctg
tcttcaccgcaggaattagatggtttaaccaatgttagtacccaggatatagtggttata
ccagcattggccggtgttaacgtgccgcctaggccatgcgcaaggggtttaattgatggc
ttaacgctaaacaccactagggaggccttcgtgagggctgttgttgagggcgtcgttcaa
ttaataggcctaatcttcgataaaattaagaattactcaagggttgatgttgttagggtt
gatggtggcttatcaaggagtgccctattccttaggttattggctacggcactaggcacc
gtcgttgaaagacagagggatgtggaggcaacggctaggggtgttgctgcattattgaag
gtgtttaggggtgattggtcattgaatgacattattaggggaattcatgttaacgtggag
ttacgaattaagcctggcgaggagagactatcattaaatagggatgttgttaagaggatt
gttgaggggatgagatgcagagcataa

DBGET integrated database retrieval system