KEGG   Vulcanisaeta moutnovskia: VMUT_1421Help
Entry
VMUT_1421         CDS       T01440                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VMUT_1421
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VMUT_1421
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VMUT_1421
Enzymes [BR:vmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VMUT_1421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1400195..1401436)
Genome map
AA seq 413 aa AA seqDB search
MMIPHYWYNINVDLPKPLPPPIDPYEVDSRIALLMRILPSELIDQEFTPLRYVPIPDEVR
ELYERMGRPTPFRRAYGLERALGNGVKIYYKFEGALPAGSHKLNTAIPQVYYAIKDGAKE
VVTETGAGQWGLAVSLAAALLSVKATVFMTKNSYLNKAQRVLFMRTYGADVYPSPSELTS
FGREALKTKPDHPGSLGLAITEAIEFTLMGEGRKYIPGSVLGFVVLHQTVIGQEVLQQMP
EEPNLVIGCVGGGSNFSGFSFPMIGAKLRNEGFEKTRFLAVESRVAPKLTSGRYMYDFPD
TGGLLPMVKMLTLGHDYVPPPTHAAGLRYHGAAPSLSMLVKEGVVEARAYGQEEVMEAAR
IFARTEGIIPAPESAHAIKAAIDEAKRMPKGSVIFFNLSGHGLLDVDAYSNTR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcccccattactggtataatataaatgtggatctgccaaagccattaccacca
cccattgatccctacgaagttgactccagaatcgcattgctcatgaggatactacccagt
gagttgattgatcaggaattcacgccacttaggtatgtgccaatacccgatgaggttagg
gagctctacgaaaggatgggtagaccaacaccgttcaggagggcctatgggctagagagg
gccttgggtaatggtgttaagatttactataagtttgagggtgcattgccagcgggctct
cataagttaaatacggcaataccccaggtttattatgcgataaaggatggtgctaaggag
gttgttacagagactggcgctggtcagtggggtctcgcagtgtcattggcagcggcatta
ctaagtgttaaggctaccgtgttcatgacgaagaattcatacctcaacaaggcacagagg
gttcttttcatgaggacttacggtgccgatgtttatccaagcccaagcgaattaacgagt
tttggtagggaggcacttaagaccaagcctgatcaccctggtagcctaggacttgcgatt
accgaggccattgagttcacactaatgggtgagggtaggaagtacataccaggcagtgta
ttgggcttcgtagtccttcaccaaacagtcatcgggcaggaggtgctacagcaaatgccc
gaggagccgaacctagtgattggttgtgttggaggtggtagtaacttcagtggtttctca
ttcccaatgataggcgctaagttgagaaatgagggttttgagaagacgaggttcctcgcc
gttgaatccagggtagcaccaaagttaaccagcggtaggtacatgtatgatttcccagat
actgggggtttattaccgatggttaagatgctcaccttgggtcatgactacgtaccacca
ccaacccatgcagctgggcttaggtaccatggtgctgcaccaagtctctcaatgcttgtt
aaggagggcgttgtggaggccagggcttatggtcaggaggaggttatggaggcggccagg
atattcgcgaggaccgagggtataatacctgccccagagtctgcgcatgcgataaaggct
gcgattgacgaggcgaagagaatgccaaagggatccgtcatattcttcaatttatcgggt
catggtctactggacgttgatgcctacagcaatactaggtga

DBGET integrated database retrieval system