KEGG   Vulcanisaeta moutnovskia: VMUT_1422Help
Entry
VMUT_1422         CDS       T01440                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VMUT_1422
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VMUT_1422
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VMUT_1422
Enzymes [BR:vmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VMUT_1422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1401433..1402152)
Genome map
AA seq 239 aa AA seqDB search
MDIRKPGLGAYITATYPNKETFLNAVKCLSGVSDFLEIGIPTQNPKYDGPVIRKTHFGSE
LKGLDAIRVTKYGDVPTILMGYIDDYVNNLGLVTETASEVGASSVLFPDLLFEHLDMLEN
YINAMREYSLRPTFFISSNTPYTLVGTLIKYEPLFIYLGLYAATGIKLPLYIERNVREVR
KLVDNITLIAGFAINTPEMVKLVISAGADAVVVGTALVDKLNDQRACVEFMTRLRGGLP
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggacataaggaaaccgggcctgggcgcatacataactgctacgtacccaaataaagaa
acgttcctaaatgctgtaaaatgcctatcaggggtttcagacttcctcgaaataggaata
ccaacacaaaatcctaagtacgatggtccagtgatcagaaagacgcacttcggctctgag
cttaagggcctagatgccattagggtgactaagtatggtgatgtaccaacaatactcatg
ggttatattgatgattacgtgaacaatctaggacttgttactgaaacagccagtgaagtt
ggagcatcctcagtattattcccagacctattatttgagcacctggatatgcttgagaat
tacataaatgccatgagggaatactcactaagacctaccttcttcatatcgagtaataca
ccatacacgttagtgggtactcttattaagtacgagccactattcatatacctaggtctc
tacgcagctacgggcataaaactaccactttatattgagaggaatgttagggaggtcagg
aagcttgttgacaatatcacgttaatcgccggtttcgccataaataccccagaaatggtt
aagctggtaatcagcgctggcgctgatgccgtggttgtcggtacggcacttgtggataaa
ctaaacgatcaaagggcatgtgtagaattcatgacaagactcaggggtggtttgccatga

DBGET integrated database retrieval system