KEGG   Vulcanisaeta moutnovskia: VMUT_1423Help
Entry
VMUT_1423         CDS       T01440                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
vmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vmo01100  Metabolic pathways
vmo01110  Biosynthesis of secondary metabolites
vmo01130  Biosynthesis of antibiotics
vmo01230  Biosynthesis of amino acids
Module
vmo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VMUT_1423
Enzymes [BR:vmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VMUT_1423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth DHO_dh NanE FMN_dh ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ADY01628
UniProt: F0QT39
Position
1402310..1403053
Genome map
AA seq 247 aa AA seqDB search
MDFLGIINELTKKRVEAIKVNARAPGMLRAIERRNSEGYLALIAEYKRASPSGVIRLDLD
PWTYFNAVGQYATGFSVLVEPIYFLGSPIFVKIALNYGKPVLYKDFVISREQIREAGELG
ASSVLLIKRLGGNALWDLVDYAMDLGLEPLIEVDDEDDALEIVNSNPNVMLGINSRDLGD
LSVSLDRAISIIRAVRSKANVIIAESGVRGVNDAVRLAREGANAILVGTALMRNVELAKE
FSGITIH
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtggatttcctaggcataattaatgaattaacaaaaaagcgtgttgaggctattaaggtt
aatgcgagggctccgggtatgcttagggcaattgaaagacgcaattccgagggttaccta
gccctgatagctgagtacaagagggcgagccccagcggcgttattaggcttgaccttgac
ccctggacctacttcaacgcggtcggtcaatacgccactggattcagcgtattagttgaa
ccaatatactttctcggttcacctatcttcgtgaagatagcccttaattacggtaagcca
gtgctgtataaggacttcgtaattagcagggagcagatcagggaggctggggaactaggt
gcaagttcagtattactcattaagagacttggtggtaatgcgctgtgggacttggtggac
tatgccatggacctgggcttagaaccccttattgaggttgatgatgaggatgatgcccta
gagatcgttaacagcaacccaaacgtaatgcttggcattaactccagggatttaggtgat
ttatcagtatccctggatagggctatttcaataattagagccgttaggagtaaggccaat
gttataattgctgagagtggtgttaggggtgttaatgatgcagtgagattggctagagag
ggcgccaatgccatacttgtgggtactgctttaatgaggaatgtggagttagcgaaggag
ttctcaggcattaccattcattaa

DBGET integrated database retrieval system