KEGG   Vulcanisaeta moutnovskia: VMUT_1423Help
Entry
VMUT_1423         CDS       T01440                                 

Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VMUT_1423
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VMUT_1423
Enzymes [BR:vmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VMUT_1423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1402310..1403053
Genome map
AA seq 247 aa AA seqDB search
MDFLGIINELTKKRVEAIKVNARAPGMLRAIERRNSEGYLALIAEYKRASPSGVIRLDLD
PWTYFNAVGQYATGFSVLVEPIYFLGSPIFVKIALNYGKPVLYKDFVISREQIREAGELG
ASSVLLIKRLGGNALWDLVDYAMDLGLEPLIEVDDEDDALEIVNSNPNVMLGINSRDLGD
LSVSLDRAISIIRAVRSKANVIIAESGVRGVNDAVRLAREGANAILVGTALMRNVELAKE
FSGITIH
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtggatttcctaggcataattaatgaattaacaaaaaagcgtgttgaggctattaaggtt
aatgcgagggctccgggtatgcttagggcaattgaaagacgcaattccgagggttaccta
gccctgatagctgagtacaagagggcgagccccagcggcgttattaggcttgaccttgac
ccctggacctacttcaacgcggtcggtcaatacgccactggattcagcgtattagttgaa
ccaatatactttctcggttcacctatcttcgtgaagatagcccttaattacggtaagcca
gtgctgtataaggacttcgtaattagcagggagcagatcagggaggctggggaactaggt
gcaagttcagtattactcattaagagacttggtggtaatgcgctgtgggacttggtggac
tatgccatggacctgggcttagaaccccttattgaggttgatgatgaggatgatgcccta
gagatcgttaacagcaacccaaacgtaatgcttggcattaactccagggatttaggtgat
ttatcagtatccctggatagggctatttcaataattagagccgttaggagtaaggccaat
gttataattgctgagagtggtgttaggggtgttaatgatgcagtgagattggctagagag
ggcgccaatgccatacttgtgggtactgctttaatgaggaatgtggagttagcgaaggag
ttctcaggcattaccattcattaa

DBGET integrated database retrieval system