KEGG   Vulcanisaeta moutnovskia: VMUT_1531Help
Entry
VMUT_1531         CDS       T01440                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VMUT_1531
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VMUT_1531
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VMUT_1531
Enzymes [BR:vmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VMUT_1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1524256..1525479
Genome map
AA seq 407 aa AA seqDB search
MQLKPLGKYVLKCPRCGYEVEPSPYIMRCPRCGELLDASIITEKIRIKWGELRGRGVWRY
RDLLPELKNVITMSEGSTPLIRLRAYPNAYVKFEGANPTGSFKDRGMTVGVSLASSLGVR
GIIVASTGNTAASAAAYSARAGIECMVVLPKGGVAKGKLGQALLHGARIVEVPGTFDNAL
EYVLSTVLESGSAGNASYYPLNSINQWRLEGQKTIAYEIVEEVGVPDYVFVPVGNGGNIY
AIWKGFGELMELNIIDKMPKMIGVQASGAAPLVKYWRGLGEARVDKPSTVASAIRIGKPI
NWYRAYRAVKYSNGFFIDASDDEILMTQRVLGREGVGVEPASAASLAGYMKALREGVIDP
SDNVVLIATGHALKDPDALLRDSVHTVSISSIDELKALIMGRSIIDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaaagccgttgggtaaatacgtccttaaatgcccaagatgtggttatgaggtt
gagcctagcccatacataatgaggtgcccacggtgtggtgaattacttgatgcatcgatt
attactgagaaaattaggattaagtggggtgagttacgtggtaggggtgtttggaggtat
agggatttactccctgagctcaaaaatgtaatcaccatgagtgaggggtcaacgccacta
attaggcttagggcttatcccaatgcctatgttaagtttgagggcgccaacccaactggg
tcctttaaggataggggtatgactgtcggtgtttcattagcctcatcattgggtgttagg
ggtattatagttgcgtccactggcaataccgcggcctcagccgcagcctactctgcaagg
gccggtattgagtgcatggttgtcctgccaaagggtggtgttgctaagggcaaactcggc
caagcattactacatggcgcaaggattgtggaggtgcctggaacatttgataatgcgtta
gagtatgtcctaagcactgttctggaaagtggtagtgcaggtaatgccagttattatccg
cttaattctataaatcagtggaggttggagggccagaagacgattgcttatgaaattgtt
gaggaggtcggtgtgcctgactacgtgtttgtccctgtgggtaatggcgggaatatttat
gctatttggaaggggtttggggaattgatggagctcaatataatagacaaaatgccaaaa
atgattggtgtacaagcctcaggagccgcaccattggtcaagtattggagaggcttaggt
gaggctagagttgataagccaagtactgtggcgtccgccataaggattggtaagccaatt
aattggtatagggcctatagggctgttaagtacagtaatggcttctttatcgatgcttcc
gacgatgagatattaatgacacagagagtgcttggtagggagggagttggtgttgaaccg
gctagtgcggcatcgttggctggttatatgaaggctttaagggagggtgtgatcgatcct
agtgataatgttgttttaatagccacaggacatgcacttaaggatccagatgcgttattg
agggatagtgttcacacggtcagtatatcatcaattgacgagctcaaagcactaatcatg
ggtagatcaatcattgatgtttag

DBGET integrated database retrieval system