KEGG   Vulcanisaeta moutnovskia: VMUT_1531Help
Entry
VMUT_1531         CDS       T01440                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VMUT_1531
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VMUT_1531
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VMUT_1531
Enzymes [BR:vmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VMUT_1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1524256..1525479
Genome map
AA seq 407 aa AA seqDB search
MQLKPLGKYVLKCPRCGYEVEPSPYIMRCPRCGELLDASIITEKIRIKWGELRGRGVWRY
RDLLPELKNVITMSEGSTPLIRLRAYPNAYVKFEGANPTGSFKDRGMTVGVSLASSLGVR
GIIVASTGNTAASAAAYSARAGIECMVVLPKGGVAKGKLGQALLHGARIVEVPGTFDNAL
EYVLSTVLESGSAGNASYYPLNSINQWRLEGQKTIAYEIVEEVGVPDYVFVPVGNGGNIY
AIWKGFGELMELNIIDKMPKMIGVQASGAAPLVKYWRGLGEARVDKPSTVASAIRIGKPI
NWYRAYRAVKYSNGFFIDASDDEILMTQRVLGREGVGVEPASAASLAGYMKALREGVIDP
SDNVVLIATGHALKDPDALLRDSVHTVSISSIDELKALIMGRSIIDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaaagccgttgggtaaatacgtccttaaatgcccaagatgtggttatgaggtt
gagcctagcccatacataatgaggtgcccacggtgtggtgaattacttgatgcatcgatt
attactgagaaaattaggattaagtggggtgagttacgtggtaggggtgtttggaggtat
agggatttactccctgagctcaaaaatgtaatcaccatgagtgaggggtcaacgccacta
attaggcttagggcttatcccaatgcctatgttaagtttgagggcgccaacccaactggg
tcctttaaggataggggtatgactgtcggtgtttcattagcctcatcattgggtgttagg
ggtattatagttgcgtccactggcaataccgcggcctcagccgcagcctactctgcaagg
gccggtattgagtgcatggttgtcctgccaaagggtggtgttgctaagggcaaactcggc
caagcattactacatggcgcaaggattgtggaggtgcctggaacatttgataatgcgtta
gagtatgtcctaagcactgttctggaaagtggtagtgcaggtaatgccagttattatccg
cttaattctataaatcagtggaggttggagggccagaagacgattgcttatgaaattgtt
gaggaggtcggtgtgcctgactacgtgtttgtccctgtgggtaatggcgggaatatttat
gctatttggaaggggtttggggaattgatggagctcaatataatagacaaaatgccaaaa
atgattggtgtacaagcctcaggagccgcaccattggtcaagtattggagaggcttaggt
gaggctagagttgataagccaagtactgtggcgtccgccataaggattggtaagccaatt
aattggtatagggcctatagggctgttaagtacagtaatggcttctttatcgatgcttcc
gacgatgagatattaatgacacagagagtgcttggtagggagggagttggtgttgaaccg
gctagtgcggcatcgttggctggttatatgaaggctttaagggagggtgtgatcgatcct
agtgataatgttgttttaatagccacaggacatgcacttaaggatccagatgcgttattg
agggatagtgttcacacggtcagtatatcatcaattgacgagctcaaagcactaatcatg
ggtagatcaatcattgatgtttag

DBGET integrated database retrieval system