KEGG   Vulcanisaeta moutnovskia: VMUT_1962Help
Entry
VMUT_1962         CDS       T01440                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
vmo00020  Citrate cycle (TCA cycle)
vmo00640  Propanoate metabolism
vmo00660  C5-Branched dibasic acid metabolism
vmo00720  Carbon fixation pathways in prokaryotes
vmo01100  Metabolic pathways
vmo01110  Biosynthesis of secondary metabolites
vmo01120  Microbial metabolism in diverse environments
vmo01130  Biosynthesis of antibiotics
vmo01200  Carbon metabolism
Module
vmo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vmo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VMUT_1962
   00640 Propanoate metabolism
    VMUT_1962
   00660 C5-Branched dibasic acid metabolism
    VMUT_1962
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    VMUT_1962
Enzymes [BR:vmo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VMUT_1962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: ADY02163
UniProt: F0QW68
Position
complement(1928021..1929145)
Genome map
AA seq 374 aa AA seqDB search
MRLLEYKGKELLNKYGVKIPRGAIVKSLDDVQVLKALKFPLFAKSQVPFAGRAKMGLVRR
VDTIKDAENAARDYLGKVIQDYPIRKVLFEEGVNVAKELYVSITLDRENRGYLMLASTEG
GIDIEEVARRSPEKIIRLYIDDYEGLRDYMIRGVAQKLGLEGSAAQDFATVAKAMYRVFT
EYDAELVEINPLALTTDGQLVALDVKVMIDDNSLFRHPDISVEDSDYTMEELEARRYGLH
YVELTGYVGIMANGAGLTMATMDLVKEFGHEPADFLDVGGGASKDSVREGLKMLLMDDRI
KAVLVNIFGGITRCDEVARGVVEALNEVKTNKPIFIRLKGTNEEEGRRILTEVGLKTYET
AEEAMEALSRAIVR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgagactcctcgagtataagggtaaggaattactgaataagtatggcgttaagataccc
aggggcgccatagtcaagagccttgatgacgtacaggtactaaaggcattgaaattccca
ttattcgcaaagtctcaagtacccttcgctggtagagctaagatgggtctagtaaggagg
gtcgatacgattaaggacgcagagaacgcagccagggattacctgggcaaggtaatccag
gactacccaattaggaaggttttgtttgaggagggtgttaatgtagccaaggagctctac
gtatcgataacactggatagggagaacaggggttacctaatgctggcctccactgaaggt
ggtattgatatcgaggaggttgccaggagaagccctgagaagataattaggctctacata
gatgattatgagggacttagggactacatgatcaggggtgtggcacagaagcttggttta
gagggatccgcggctcaggactttgcaactgtggctaaggcaatgtatagagtattcacg
gaatatgatgcagagcttgtggagataaacccactggcattaacaactgatggtcaatta
gtagccctcgatgttaaggtcatgattgacgacaactcattgtttaggcacccagacatt
agtgttgaggatagtgactacacaatggaagagcttgaggctaggaggtacgggcttcac
tacgtggagttgacgggttacgtgggaatcatggccaacggcgccggtctaacaatggca
acaatggacctagttaaggagtttggccatgaaccggctgatttcttagatgttggtggt
ggagccagtaaggactccgttagggaggggttaaagatgcttttaatggatgataggata
aaggcagtcctagtgaacatatttgggggaataacgaggtgtgatgaggtggcgaggggt
gtggttgaggctttgaatgaggttaagaccaataaaccaatattcattaggctgaagggc
actaatgaggaggagggtaggagaatactgactgaggtagggcttaaaacctatgaaacg
gctgaggaggcaatggaagcactatcaagggcaattgtgaggtga

DBGET integrated database retrieval system