KEGG   Vulcanisaeta moutnovskia: VMUT_1962Help
Entry
VMUT_1962         CDS       T01440                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VMUT_1962
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VMUT_1962
   00640 Propanoate metabolism
    VMUT_1962
   00660 C5-Branched dibasic acid metabolism
    VMUT_1962
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    VMUT_1962
Enzymes [BR:vmo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VMUT_1962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1928021..1929145)
Genome map
AA seq 374 aa AA seqDB search
MRLLEYKGKELLNKYGVKIPRGAIVKSLDDVQVLKALKFPLFAKSQVPFAGRAKMGLVRR
VDTIKDAENAARDYLGKVIQDYPIRKVLFEEGVNVAKELYVSITLDRENRGYLMLASTEG
GIDIEEVARRSPEKIIRLYIDDYEGLRDYMIRGVAQKLGLEGSAAQDFATVAKAMYRVFT
EYDAELVEINPLALTTDGQLVALDVKVMIDDNSLFRHPDISVEDSDYTMEELEARRYGLH
YVELTGYVGIMANGAGLTMATMDLVKEFGHEPADFLDVGGGASKDSVREGLKMLLMDDRI
KAVLVNIFGGITRCDEVARGVVEALNEVKTNKPIFIRLKGTNEEEGRRILTEVGLKTYET
AEEAMEALSRAIVR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgagactcctcgagtataagggtaaggaattactgaataagtatggcgttaagataccc
aggggcgccatagtcaagagccttgatgacgtacaggtactaaaggcattgaaattccca
ttattcgcaaagtctcaagtacccttcgctggtagagctaagatgggtctagtaaggagg
gtcgatacgattaaggacgcagagaacgcagccagggattacctgggcaaggtaatccag
gactacccaattaggaaggttttgtttgaggagggtgttaatgtagccaaggagctctac
gtatcgataacactggatagggagaacaggggttacctaatgctggcctccactgaaggt
ggtattgatatcgaggaggttgccaggagaagccctgagaagataattaggctctacata
gatgattatgagggacttagggactacatgatcaggggtgtggcacagaagcttggttta
gagggatccgcggctcaggactttgcaactgtggctaaggcaatgtatagagtattcacg
gaatatgatgcagagcttgtggagataaacccactggcattaacaactgatggtcaatta
gtagccctcgatgttaaggtcatgattgacgacaactcattgtttaggcacccagacatt
agtgttgaggatagtgactacacaatggaagagcttgaggctaggaggtacgggcttcac
tacgtggagttgacgggttacgtgggaatcatggccaacggcgccggtctaacaatggca
acaatggacctagttaaggagtttggccatgaaccggctgatttcttagatgttggtggt
ggagccagtaaggactccgttagggaggggttaaagatgcttttaatggatgataggata
aaggcagtcctagtgaacatatttgggggaataacgaggtgtgatgaggtggcgaggggt
gtggttgaggctttgaatgaggttaagaccaataaaccaatattcattaggctgaagggc
actaatgaggaggagggtaggagaatactgactgaggtagggcttaaaacctatgaaacg
gctgaggaggcaatggaagcactatcaagggcaattgtgaggtga

DBGET integrated database retrieval system