KEGG   Vulcanisaeta moutnovskia: VMUT_1969Help
Entry
VMUT_1969         CDS       T01440                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VMUT_1969
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VMUT_1969
Enzymes [BR:vmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     VMUT_1969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1935829..1936725
Genome map
AA seq 298 aa AA seqDB search
MLDFGREDFEVLLSETLNMEKYAKSKLDILGDKVLALAFFEPSTRTRLSFETAMLRLGGK
VIGFSGTEATSMVKGENLADTIRMLDAYANAIVIRHSLEGTAKFAAEIAGSPVINAGDGS
QNHPTQAMLDLYTIWREFKVIDGLSIGILGDLRYARVVNSLIQALSYYRIKLHLISPELL
KPRQELIEFMKSRDMKYDWTDDPYNVINDLDVLYIVRIQRERFPDPMEYERVKGTYKVMP
KLIERSKPSLIILHPLPRVDEVDFTVDSMPQAKYFKQAGLGVPLRMALLKLVLAGDKS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgctggatttcggtagggaggattttgaggtcttgctttccgagactttgaacatggag
aagtatgctaagtcaaaacttgatattcttggtgataaggtccttgccctggcattcttt
gagcccagcactaggactaggcttagctttgagactgccatgctcaggcttggtggtaag
gtgattggtttcagtggtactgaggctacatcaatggttaagggcgagaacttagctgat
accattaggatgcttgacgcgtatgccaacgccatagttattaggcatagccttgaggga
accgctaaattcgcagctgagattgctgggtcaccggtgattaatgcaggtgatggctcg
cagaatcacccgacacaagcaatgcttgatctgtacacgatttggcgggagtttaaggtt
attgatggcctatcgatcggcatacttggtgaccttaggtatgccagggtagttaattca
ttaatccaagccctgtcctactacaggattaagcttcacttaatatcgccagagctactc
aagcctaggcaggaactcattgaattcatgaaatcaagggatatgaagtatgattggact
gatgatccatacaacgtgattaatgacttggacgtgctttatatcgttaggattcagagg
gagaggtttcctgatccaatggagtatgagagggttaagggcacgtataaggtcatgcct
aagttgattgagaggagtaagccaagcctaataatacttcatccacttccaagagttgat
gaggtcgacttcactgtggatagcatgccacaagccaagtactttaagcaggctggttta
ggtgtgccattacgcatggccttgcttaagttagtccttgctggtgataagtcatga

DBGET integrated database retrieval system