KEGG   Vulcanisaeta moutnovskia: VMUT_2092Help
Entry
VMUT_2092         CDS       T01440                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VMUT_2092
   01230 Biosynthesis of amino acids
    VMUT_2092
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VMUT_2092
   00051 Fructose and mannose metabolism
    VMUT_2092
   00562 Inositol phosphate metabolism
    VMUT_2092
Enzymes [BR:vmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VMUT_2092
Exosome [BR:vmo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VMUT_2092
  Exosomal proteins of bladder cancer cells
   VMUT_2092
  Exosomal proteins of melanoma cells
   VMUT_2092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2050625..2051296
Genome map
AA seq 223 aa AA seqDB search
MRLPVLIINMKVYPEVLGKRALELAKVAEAVSRELGVSIAVAPPVTELRLVAESVGIPVY
AQGADSVEPGARTGHVPLEFVKETGASGVILNHSENRLLLNDLGWLVSRAKSLGLETLVC
APDPYTSAAAAALEPTAVAVEPPELIGTGKAVSREKPDVIVKTVGLIKRVNPGIPVITGA
GIENYEDVKKALELGTQGVLVASAIVRARDWRQKIMELAKALH
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgccagtacttatcataaacatgaaggtataccctgaggtacttggtaaaagg
gctctcgagctagccaaagtcgcagaggccgtgtctagggaattaggcgtatcaattgca
gtcgccccaccagtcactgagcttaggcttgtggctgagagcgtggggatacccgtttat
gcacagggtgccgactcagtcgagcctggggctaggactggccatgtaccacttgagttc
gttaaggagactggggcttcgggggtaatacttaaccatagtgagaataggttgttactt
aacgaccttggttggctcgttagtagggcaaagagccttggtctggagaccctcgtgtgc
gcgcctgacccatacacaagcgctgctgccgcggccctggagccaacggctgtggctgtt
gagccgcctgagctcattggtacaggtaaggctgtgagtagggagaagcctgacgtcatt
gtgaagaccgtggggctcatcaagagggttaacccaggcattcccgtgattacgggagcc
ggtattgaaaactacgaagatgttaagaaggccctagagcttggcacgcagggtgtattg
gttgcgagcgcaattgttagggctagggattggagacagaagattatggagcttgcgaag
gctttacactag

DBGET integrated database retrieval system