KEGG   Vulcanisaeta moutnovskia: VMUT_2092Help
Entry
VMUT_2092         CDS       T01440                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
vmo00010  Glycolysis / Gluconeogenesis
vmo00051  Fructose and mannose metabolism
vmo00562  Inositol phosphate metabolism
vmo01100  Metabolic pathways
vmo01110  Biosynthesis of secondary metabolites
vmo01120  Microbial metabolism in diverse environments
vmo01130  Biosynthesis of antibiotics
vmo01200  Carbon metabolism
vmo01230  Biosynthesis of amino acids
Module
vmo_M00002  Glycolysis, core module involving three-carbon compounds
vmo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VMUT_2092
   00051 Fructose and mannose metabolism
    VMUT_2092
   00562 Inositol phosphate metabolism
    VMUT_2092
Enzymes [BR:vmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VMUT_2092
Exosome [BR:vmo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VMUT_2092
  Exosomal proteins of bladder cancer cells
   VMUT_2092
  Exosomal proteins of melanoma cells
   VMUT_2092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS His_biosynth Trp_syntA NMO NanE FMN_dh IMPDH
Motif
Other DBs
NCBI-ProteinID: ADY02289
UniProt: F0QWS2
Position
2050625..2051296
Genome map
AA seq 223 aa AA seqDB search
MRLPVLIINMKVYPEVLGKRALELAKVAEAVSRELGVSIAVAPPVTELRLVAESVGIPVY
AQGADSVEPGARTGHVPLEFVKETGASGVILNHSENRLLLNDLGWLVSRAKSLGLETLVC
APDPYTSAAAAALEPTAVAVEPPELIGTGKAVSREKPDVIVKTVGLIKRVNPGIPVITGA
GIENYEDVKKALELGTQGVLVASAIVRARDWRQKIMELAKALH
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgccagtacttatcataaacatgaaggtataccctgaggtacttggtaaaagg
gctctcgagctagccaaagtcgcagaggccgtgtctagggaattaggcgtatcaattgca
gtcgccccaccagtcactgagcttaggcttgtggctgagagcgtggggatacccgtttat
gcacagggtgccgactcagtcgagcctggggctaggactggccatgtaccacttgagttc
gttaaggagactggggcttcgggggtaatacttaaccatagtgagaataggttgttactt
aacgaccttggttggctcgttagtagggcaaagagccttggtctggagaccctcgtgtgc
gcgcctgacccatacacaagcgctgctgccgcggccctggagccaacggctgtggctgtt
gagccgcctgagctcattggtacaggtaaggctgtgagtagggagaagcctgacgtcatt
gtgaagaccgtggggctcatcaagagggttaacccaggcattcccgtgattacgggagcc
ggtattgaaaactacgaagatgttaagaaggccctagagcttggcacgcagggtgtattg
gttgcgagcgcaattgttagggctagggattggagacagaagattatggagcttgcgaag
gctttacactag

DBGET integrated database retrieval system