KEGG   Vulcanisaeta moutnovskia: VMUT_2092Help
Entry
VMUT_2092         CDS       T01440                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:vmo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vmo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vmo00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:vmo00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:vmo00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2050625..2051296
Genome map
AA seq 223 aa AA seqDB search
MRLPVLIINMKVYPEVLGKRALELAKVAEAVSRELGVSIAVAPPVTELRLVAESVGIPVY
AQGADSVEPGARTGHVPLEFVKETGASGVILNHSENRLLLNDLGWLVSRAKSLGLETLVC
APDPYTSAAAAALEPTAVAVEPPELIGTGKAVSREKPDVIVKTVGLIKRVNPGIPVITGA
GIENYEDVKKALELGTQGVLVASAIVRARDWRQKIMELAKALH
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgccagtacttatcataaacatgaaggtataccctgaggtacttggtaaaagg
gctctcgagctagccaaagtcgcagaggccgtgtctagggaattaggcgtatcaattgca
gtcgccccaccagtcactgagcttaggcttgtggctgagagcgtggggatacccgtttat
gcacagggtgccgactcagtcgagcctggggctaggactggccatgtaccacttgagttc
gttaaggagactggggcttcgggggtaatacttaaccatagtgagaataggttgttactt
aacgaccttggttggctcgttagtagggcaaagagccttggtctggagaccctcgtgtgc
gcgcctgacccatacacaagcgctgctgccgcggccctggagccaacggctgtggctgtt
gagccgcctgagctcattggtacaggtaaggctgtgagtagggagaagcctgacgtcatt
gtgaagaccgtggggctcatcaagagggttaacccaggcattcccgtgattacgggagcc
ggtattgaaaactacgaagatgttaagaaggccctagagcttggcacgcagggtgtattg
gttgcgagcgcaattgttagggctagggattggagacagaagattatggagcttgcgaag
gctttacactag

DBGET integrated database retrieval system