KEGG   Vulcanisaeta moutnovskia: VMUT_2198Help
Entry
VMUT_2198         CDS       T01440                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vmo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2151962..2153014
Genome map
AA seq 350 aa AA seqDB search
MVTTESIRLRSYLFNYPVNRPRRLRSNVLIRNMVAETMLRPDDFVMPIFVREDINEPEPI
KSLPGQYRWPLNDKILNFVDQLINSGIKSVILFGIPEHKDEWGSSAYDEHGIIQRTIRFL
KDSFEDKLIVMADVCLCEYTDHGHCGIVKRLSDGKYVVDNDSTIELYAKTAVTYAESGVD
VVAPSGMMDGQVKAIREALDRAGFSDVIIMAYSAKYASSFYGPFREAAASAPKFGDRRSY
QMDPRNAHEALKEVVMDINEGADIVMVKPAMLFLDVIRLVKQNFPEIPLAAYQVSGEYAM
LKAAIMNGWLDEKKAILESLIAIRRAGADLIITYFAKDVVAYLDEIERLF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtggttactactgaaagtattaggttgaggagttacttgtttaattatcccgtcaatagg
cctaggaggcttaggtcgaatgtcctcattaggaatatggtcgctgaaacgatgcttagg
cccgatgactttgtaatgccaatattcgttagggaggatattaacgagccggaacccatt
aagtcattacctgggcagtataggtggccgctcaatgataaaatacttaattttgtcgat
caattgattaattctggcattaagtcagttattttgtttggcatacctgagcataaggat
gagtggggtagttcggcatatgatgagcatggtataatacagaggacaattaggttcttg
aaggactcctttgaggataaactcattgtaatggctgatgtatgtctttgtgagtataca
gaccatggtcattgtggcattgttaagagattgtccgatggcaagtatgttgtggataat
gattcaacaatagagctctatgcaaaaacggccgtaacgtatgcggagtctggtgttgat
gttgttgcgccgtcgggtatgatggatgggcaggtcaaggcgattagggaggcccttgat
agggcaggttttagtgatgtcattataatggcctatagcgccaagtacgcaagttcattc
tatggtccatttagggaggccgcggctagtgcccctaagtttggcgataggcgtagttac
cagatggacccaaggaacgcccatgaggcccttaaggaggttgtcatggacattaacgag
ggcgccgacatagtcatggtcaaaccggcaatgctctttctcgacgttattaggcttgtt
aaacagaatttcccagagataccgctggctgcttatcaggtaagtggtgagtatgcaatg
ctcaaggcagccataatgaatggttggcttgatgagaagaaggctattctcgagtcctta
attgccattaggagggctggagcagatttaataattacgtattttgcaaaggatgttgtt
gcttaccttgatgaaattgagcgactcttttaa

DBGET integrated database retrieval system