KEGG   Vulcanisaeta moutnovskia: VMUT_2322Help
Entry
VMUT_2322         CDS       T01440                                 

Definition
fructose-bisphosphate aldolase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VMUT_2322
   01230 Biosynthesis of amino acids
    VMUT_2322
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VMUT_2322
   00030 Pentose phosphate pathway
    VMUT_2322
   00051 Fructose and mannose metabolism
    VMUT_2322
  Energy metabolism
   00680 Methane metabolism
    VMUT_2322
Enzymes [BR:vmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     VMUT_2322
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     VMUT_2322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2274447..2275652
Genome map
AA seq 401 aa AA seqDB search
MKTTVSIIKADIGGLPGHAWVHPKILEFAAERLKEEQKRGLLIDYFVYNVGDDMSLLMTH
TKGENNPDIHGLAWSIFKEATENIAKKVKLYGAGQDLLKDTFSGNVRGLGPQVAEMEFEE
RPSEPLVVFAADKTEPGAFNLPFYKIFADPFNTAGLVIDPAMHEGFRFEILDVYEGKVYL
LDAPENSYDILGLIGTPGRYIIRRIYRKADFVQASVTSVERLNLIAGHYVGKDDPVAMVR
AQHGLPAVGEILEAFAYPHLVEGWMRGSHVGPLMPSKMISIDLEKRIAMGPKMTRFDGPP
KVIAIGFQVHDGYLEGPVDLFDDPAFDYSRQLAAQITDYIRRMGPVMPHRLPPEEMEYTT
LPQILSKLKSVPVDEYEKNRLQYIQFVSSQVGQSVTGPSHD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccacggtctcaataataaaggccgacataggtggcttacctggacacgcttgg
gtgcatccaaagatacttgaattcgctgctgaaagactaaaggaggaacaaaagaggggc
ttattgattgattattttgtgtataatgttggtgacgacatgtcattactcatgactcac
acgaagggtgagaataaccctgatattcatggattagcttggtcaatatttaaggaggcc
acagaaaacatcgcaaagaaggttaaactctacggtgcaggccaggacctacttaaggac
acattcagtggaaatgtcaggggtttaggtccccaggttgccgagatggagtttgaggaa
agacccagtgaacctctcgtggtatttgctgcggataagaccgaaccaggcgccttcaat
ttaccattctataaaatatttgccgacccatttaacacggctgggcttgttattgaccca
gcaatgcatgaagggtttagattcgagatacttgatgtatatgaaggtaaggtttaccta
cttgatgctcccgagaatagttatgatatactaggcctaataggtactccaggtagatac
ataataagaaggatatatagaaaggccgattttgttcaggcctctgtaactagtgttgaa
aggctgaatttaattgcaggtcattatgtaggtaaggatgatccagtagccatggttagg
gcgcaacatggcttaccagctgttggtgagatccttgaggcctttgcttatccgcatctt
gttgagggttggatgaggggtagccatgttggtccattaatgccctcaaagatgataagt
attgacctggagaagaggattgccatggggcctaagatgaccaggtttgatgggccacca
aaggtaatagctattggtttccaggttcatgacggttatctagaaggacctgttgattta
tttgatgacccagcctttgattatagcaggcagttagctgctcagataacggattacata
aggagaatgggcccagtaatgccccataggttaccgcctgaggagatggagtacacgaca
ttaccacaaatactctcgaagttaaagtccgtgcctgttgatgagtatgagaagaatagg
cttcaatacattcaattcgtgtcatcacaggtaggacaatcagttactggtcctagtcac
gattaa

DBGET integrated database retrieval system