KEGG   Vibrio nigripulchritudo: VIBNI_A0494Help
Entry
VIBNI_A0494       CDS       T02871                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vni  Vibrio nigripulchritudo
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vni00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VIBNI_A0494 (deoA)
Enzymes [BR:vni01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     VIBNI_A0494 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:538081..539409
Genome map
AA seq 442 aa AA seqDB search
MYLPQEIIRKKRDGEVLSAEEIQFFIQGVAKGEVSEGQIAAFAMAIFFNEMSMPERIALT
CAMRDSGMVINWDHMNFGGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHT
GGTLDKLESIPGYNITPNNEVFGDVTKEAGVAIIGQTGDLAPADKRVYATRDITATVDNI
SLITASILSKKLAAGLDSLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTAILT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLLEITLALCSEMLVLGKLADNTEDARKKL
MAVLDNGKAAECFGKMVAGLGGPVDFVENYDNYLEKAEIIKPVYAKESGVVSSMDTRAIG
MAVVAMGGGRRVATDSIDYAVGFDQFIRLGEVANSETPLAMIHARSEEQWSEAAEALQSA
IVVGGEYQKTPDVYRQIRAEDV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatttacctcaagaaattatccgtaaaaagcgtgacggcgaagtgctgtctgcggaa
gaaattcaattctttatccagggcgttgccaaaggagaagtgtctgaagggcaaatcgcg
gcattcgcgatggccattttcttcaatgaaatgagcatgcctgagcgaatcgcactgact
tgtgcgatgcgagattctggcatggtcatcaattgggatcacatgaactttggtggtccg
attgtcgataaacactccactggtggtgtgggagatgtcacgtccttgatgcttggtcct
atggtggcggcgtgcggcgggtttgtccctatgatttccggtcgtgggctgggacatact
ggcggcacactggacaagctggaatccattccgggctacaacattacgccaaacaacgaa
gtgtttggtgatgtgaccaaagaagcgggcgttgcaattatcggtcagacaggtgacctc
gctcctgctgataaacgtgtttacgctacccgcgatatcacggcgaccgtcgataacatt
tccctgatcaccgcgtctattctgtctaagaagctggctgccggtctggactcactggtt
atggacgtaaaagtcggttctggtgcctttatgccaacttacgaagcgtctgaagagctg
gcgaaatcgatcgttgcggtagccaacggtgctggcactaaaaccaccgccatcctcacc
gatatgaatcaggtgctggcttcctctgcgggtaatgcggtggaagtgcgtgaagcggtg
cagtttttgactggagaataccgcaacccacgtttgctggagatcaccttagcgctgtgc
agtgaaatgctggtactgggcaagcttgcagacaataccgaagatgcacgcaaaaagctg
atggctgtactggataacggaaaagccgcagaatgctttggcaagatggtggctggctta
ggcggtcctgtcgacttcgttgaaaactacgacaattacctcgaaaaagccgagatcatc
aaaccggtttatgccaaagagagtggcgttgtttcctcaatggatacccgagccatcggc
atggcagtcgtggctatgggcggtggtcgtcgcgtggctacggactctatcgactacgct
gtcggttttgaccagtttattcgccttggtgaagttgccaacagcgaaactccgttagcg
atgattcatgcccgcagtgaagagcagtggagtgaagccgctgaagcactgcaaagcgcc
attgttgttggtggcgagtatcagaagacaccagacgtttaccgtcagatccgagctgaa
gacgtgtaa

DBGET integrated database retrieval system