KEGG   Vibrio nigripulchritudo: VIBNI_A1113Help
Entry
VIBNI_A1113       CDS       T02871                                 

Definition
putative decarboxylase
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
vni  Vibrio nigripulchritudo
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vni00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    VIBNI_A1113
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VIBNI_A1113
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VIBNI_A1113
   00430 Taurine and hypotaurine metabolism
    VIBNI_A1113
Enzymes [BR:vni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VIBNI_A1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1196422..1198077)
Genome map
AA seq 551 aa AA seqDB search
MVSENKTADVSFESLLKIFTVPEAPDSTLGHIENKLSQNLNQFLREHIVAEEKPLADIEQ
QFSNPYLPEQPQFVSEHTQNLLDNLVSQSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHGLIYHEKPEFYQQWMHSANHSLGAFCSGGTIANITA
LWVARNNTLKADGEFKGVEKEGLFKAMKHYGYEGLAILVSERGHYSLKKAADVLGLGQEC
LVSVKTDSKNKLCPDDLEQKIALLKSQNIKPFAIVGVAGTTETGNIDPLERIAVISQKHG
CHFHVDAAWGGATLMSNNYRHLLKGIELADSVTIDAHKQLYIPMGAGMVLFKDPSAMTAI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYSSMHIISRPGYELLIDQSIEKAKYFASL
VSEQDDFELVTEPELCLLTYRYVPEVAKKALVNANEDEKGALHEALNNLTKQIQKKQRET
GKTFVSRTRLNPVQWQHRNTIVFRVVLANPLTTHEILQSVLCEQREIAAGFPNLMTQVSE
LSMEILNKKAS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggtatctgagaataaaacagcagatgtaagctttgaaagtttgctgaaaatctttact
gtgccagaagcgccagattccacattaggtcatatcgaaaacaaactctcgcaaaacctg
aaccagtttttgcgtgaacatattgttgcggaagaaaaaccgctggcggatattgaacag
cagttttcgaacccttatttgcccgagcaacctcagtttgtatctgaacatacgcagaac
ttgctcgataacctcgtttcgcagtccgttcatacctcggcacccagtttcatcggtcat
atgacttcagccctgccctactttttgatgccactatcaaaaattatgatcgcgctgaac
caaaacttggtgaagatcgaaacctcaaaagctttcaccccattggaaagacaagttctt
ggtatgcttcatggtcttatctaccatgaaaagccagagttttatcagcaatggatgcac
agcgccaatcattcactaggcgcattctgctctggcggcactattgcgaatatcactgct
ctctgggttgcaaggaacaacacgctaaaagcagatggcgaattcaaaggggtagaaaaa
gaaggcttattcaaagccatgaagcattatggctacgagggtttagctattttagtttca
gagcgcggacactactctttgaaaaaagcagcagatgttttgggattaggtcaggaatgc
ctcgtttcagtcaaaacagacagtaaaaacaaactgtgccctgacgaccttgaacaaaaa
atcgccttacttaaaagccagaacatcaaaccatttgctatcgtcggtgtcgcaggtact
accgaaacaggaaacattgatccgctagaacgaatcgcggtgatcagccagaaacacggc
tgccatttccatgtggatgctgcctggggtggcgcaaccctgatgtcgaacaactatcgc
catttacttaaagggattgagctagcagattcggtcaccattgatgcccataagcagcta
tacataccgatgggtgctggcatggttctgtttaaagatccaagcgctatgaccgccatt
gagcatcacgcacagtacatcctccgtaaagggtcgaaagacctaggcagtcatacactg
gaaggctcccgttcgggaatggcgatgctggtttattcgagcatgcacatcataagtcgc
ccaggttatgaactcttaattgatcagagtatagaaaaggcaaaatacttcgcctcgttg
gtttctgaacaagatgattttgagctggtgacggaaccagagctttgtcttcttacgtat
cgctatgttccagaagtagcgaaaaaagcgttagttaatgcgaatgaagacgagaaaggt
gcccttcacgaagctttgaacaatttgacaaagcaaattcaaaagaagcaaagggaaaca
ggtaaaacctttgtatcaagaacccgattgaacccagtacagtggcagcacagaaatacc
attgttttccgcgtagttctggctaacccacttactacacatgaaatattgcaatcggta
ttatgtgagcaaagggaaattgctgccggttttcctaatctaatgactcaagtatctgag
ctttctatggaaattttgaataagaaggcaagctaa

DBGET integrated database retrieval system