KEGG   Vibrio nigripulchritudo: VIBNI_A2416Help
Entry
VIBNI_A2416       CDS       T02871                                 

Gene name
aat
Definition
Aspartate aminotransferase (EC:2.6.1.1)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vni  Vibrio nigripulchritudo
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vni00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    VIBNI_A2416 (aat)
   01230 Biosynthesis of amino acids
    VIBNI_A2416 (aat)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VIBNI_A2416 (aat)
   00290 Valine, leucine and isoleucine biosynthesis
    VIBNI_A2416 (aat)
Enzymes [BR:vni01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     VIBNI_A2416 (aat)
    2.6.1.66  valine---pyruvate transaminase
     VIBNI_A2416 (aat)
Amino acid related enzymes [BR:vni01007]
 Aminotransferase (transaminase)
  Class I
   VIBNI_A2416 (aat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2571138..2572352
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGLLNLDVEDVYIGNGVSELIVMAMQALLDNGD
EMLVPAPDYPLWTAAVSLSGGNAVHYLCDEESDWYPDLEDIKAKITPKTRGLVLINPNNP
TGAVYSRDFLLEIVEIARQHKLIIFADEIYDKVLYDGATHTSISTLADDVLMVTFNGLSK
AYRVCGFRGGWMFLTGPKAQAKGYVDGLDMLSSMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDKAYEMITQIPGISCVKPKGAMYLFPKIDVKKFNISNDLKFVQDFLIQEK
VLLVQGSGFNWPKPDHFRIVTLPHIEDLETAIGRLDRFLTTYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcatcaaaactcgacaatgtctgctacgacattcggggtcct
gtactcaaacatgctaaacgcatggaagaagaggggcataaaatactaaagctgaatatc
ggtaatcccgccccgtttggctttgatgcccctgatgaaatcctggttgacgtaatccgc
aatcttcccacctcgcagggctactgcgactccaaaggtatttactcggcgagaaaagcc
gtggttcagcattatcagcgtaaaggcttactgaatttagatgttgaagacgtgtacatt
gggaatggtgtatctgagctgattgtgatggcaatgcaggctcttctggataacggtgac
gaaatgttggtgcctgcgccagattacccgttgtggacagcggctgtgtctctatctgga
ggtaatgctgttcactacctttgtgatgaagaatcagactggtatccagatcttgaagat
atcaaagccaaaatcacgcctaaaactcgtgggctggtactgatcaacccgaacaaccca
actggtgccgtatacagtcgggactttcttttagagatagttgaaattgctcgtcagcat
aaactgatcatctttgctgacgagatctacgataaagtcctttatgacggcgcaacccac
acatccatttccacgcttgctgatgatgttttgatggtgacattcaacggtctttctaaa
gcctatcgcgtgtgtggtttccgcggtggctggatgtttttgacaggtcctaaggcgcaa
gccaaaggttatgtcgatgggttagacatgctgtcgtcgatgcgcctgtgtgccaatgta
ccaatgcaacacgcgatacaaacggctttaggcggctaccagagtattaacgaactgatt
ttgccaggtggacgcttgttggagcagcgagacaaagcctacgagatgatcactcaaatt
cccgggatcagttgcgttaaacctaagggcgccatgtatctgttccctaaaattgatgtg
aaaaaattcaatatcagtaacgatttgaaattcgtacaggattttctgattcaggaaaaa
gtactgctggttcagggaagtgggtttaactggccaaaaccggaccacttccggattgtg
actttgcctcacattgaagacttagagacagccattggaaggctggatcgcttcctgact
acatatcgtcagtaa

DBGET integrated database retrieval system