KEGG   Vibrio nigripulchritudo: VIBNI_B0090Help
Entry
VIBNI_B0090       CDS       T02871                                 

Definition
putative Amine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
vni  Vibrio nigripulchritudo
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:vni00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VIBNI_B0090
   00330 Arginine and proline metabolism
    VIBNI_B0090
   00340 Histidine metabolism
    VIBNI_B0090
   00350 Tyrosine metabolism
    VIBNI_B0090
   00360 Phenylalanine metabolism
    VIBNI_B0090
   00380 Tryptophan metabolism
    VIBNI_B0090
Enzymes [BR:vni01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     VIBNI_B0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(102483..104249)
Genome map
AA seq 588 aa AA seqDB search
MTKTLDDAYHGLLPFDQDQISQAYLSYLQNGLPTSQAQAKNILIVGCGISGMVSATLLRQ
AGHNVTIVEANTRVGGRVKTFRNTNDKTYFEDSNLTGEAGAMRIPDMHKLVQYLIDQTGV
DKQLFLNKTVSKEDATSEQIDNPDRDENGDIILPPSTGKNFLHVNYRHVLRKDYEAEDAD
VNALLNYNLEDHENHRASVLLDNAISELTKMVEEDPKTAWAYIIDTYGEYSMRRYLLEYV
ENSEHYSENAIEMIGVIENLASRMSYSFIQSFIELAIIKPDTAFWLIKGGTDLFTTAYFE
QNNLSDVTLSNQTLTDLYLDENTGKVRIHTSVSEAIASREEQDKNVQADLAQREWDEVVV
TVPFPSFRTVHVWPEFSQRKRQAIRELHYDAATKVLLEFRERFWETENDIYGGGSCTDLI
NRFMYYPSERMGSNGGGVMLVSYSWADDARKWDSMPHYERFCYALENVAITHAVHAPDAS
YEERLIAQQKIKDLCVFDPEKYVDDQDNIVGAATVSWMQNPYAFGEAAIYYPGQLELFHK
SIIASEWQGKAHFAGEHASLKHAWIEGAIESAVNAALLVNENPLPTLS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacactcgatgatgcctaccatggattactgccattcgatcaggaccaaata
agccaagcctacttgagctatctgcaaaatggacttccaaccagtcaagctcaagctaaa
aacatcctgatagtcggttgtggaatctccggtatggtctcagctactctgttacgtcag
gcaggtcataacgtcaccatagttgaagcgaatacccgagttggtggacgagtgaaaact
ttccgcaataccaacgacaaaacctattttgaagactcgaatttgacaggcgaagcaggt
gctatgcgtatcccggatatgcacaagctggtgcagtatctgattgatcagacgggtgta
gacaaacaactgtttttgaataaaaccgtctctaaagaagatgctacatctgagcaaatc
gacaaccctgatcgcgatgaaaacggagacatcatcctcccaccttcaacaggtaaaaac
tttctgcacgttaactatcgccatgttttgcgcaaagactacgaagctgaagacgcagac
gttaacgcacttctgaactacaacctggaagaccatgagaaccatcgggcaagcgtttta
ttagacaatgctattagcgaactcaccaagatggtagaagaagatccaaaaacagcctgg
gcatacatcatcgatacctatggtgagtattcgatgcgtcgatacttgctggaatacgtg
gaaaacagcgagcattattctgaaaatgctattgaaatgattggcgtgatcgagaacctg
gcgtctcgcatgtcgtactccttcatccaaagctttatcgaacttgccatcatcaaaccc
gacaccgcattctggctgatcaaaggtgggaccgacctctttaccaccgcatactttgag
caaaacaacctatccgacgttaccctaagcaaccaaaccctgactgacctttaccttgat
gaaaatacaggcaaagtgcgcattcatacctctgtgtctgaagccatcgcttctcgcgaa
gagcaagacaaaaatgttcaggcggatctggcacagcgagaatgggatgaagtcgtggta
accgttccgttcccaagtttccgtactgttcacgtatggccagaattcagccagcgtaaa
cgtcaggctatccgcgagctgcattacgacgcagctaccaaagtactgcttgaattccgc
gagcgattctgggaaaccgaaaacgacatctacggtggcggttcctgcaccgacttaatc
aaccgctttatgtactacccaagcgagcgcatgggttcaaacggtggcggagtcatgttg
gtgagctattcctgggccgatgatgcccgtaagtgggattccatgcctcactatgagcgc
ttctgctatgcgcttgagaatgtcgccattacccacgcagttcacgcccctgacgccagc
tacgaagagcgtttgattgcccagcaaaagatcaaagacctgtgtgtatttgaccctgaa
aaatacgtcgacgaccaagacaacatcgtcggtgccgcaaccgtaagctggatgcagaac
ccttatgcgttcggtgaggctgccatctactaccccggacagcttgaattgttccacaaa
tccatcatcgccagcgagtggcaaggaaaagcgcactttgccggtgagcatgcgtcactc
aaacatgcatggatagaaggggcaatcgaatcggcagtaaatgcagcgttactggtgaat
gaaaacccacttccaacgctttcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system