KEGG   Vibrio nigripulchritudo: VIBNI_B0129Help
Entry
VIBNI_B0129       CDS       T02871                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vni  Vibrio nigripulchritudo
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vni00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VIBNI_B0129 (rbsK)
Enzymes [BR:vni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VIBNI_B0129 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:142644..143570
Genome map
AA seq 308 aa AA seqDB search
MSKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARLNADIGFIAC
VGDDAFGLNIRESFQRDGIDIRGVKVQPDCPTGIAMIQVSDDGENTICLSAEANARLSSE
AIQSELDQIRTANYLLMQLETPLDGVESAAVAAKESKTCVVLNPAPACPLPDSLLRCVDV
ITPNETEAEVLTGIKVTDEESAQQASNALHEKGIETVLITLGAKGVWLSQNGVGKGISSY
RVEAVDTTAAGDTFNGALVTGLLESKPLESAIQFANAAAALSVTRFGAQTSIPTRKEVDD
FLAKQLNT
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttagtggtgttaggcagtgtcaatgcagatcatgtgttgcaagttccttct
ttccctcgcccgggcgagacgttacacgggcgaaactatcaggttataccgggaggtaaa
ggcgccaatcaggcagtcgcagccgctcgcctgaacgcggatatcggatttattgcctgt
gtcggggacgatgcttttgggctcaatatccgagagagctttcagagggatggtattgat
attcgtggggtaaaagtgcagcccgattgcccgacaggtatcgccatgattcaggtatct
gatgatggcgaaaacacgatttgcttatcggcggaagccaacgccaggctgtcttcagaa
gcaatacaatctgaactggatcagattcgcactgcgaattacctgttaatgcaactcgaa
acgcctttggatggggtagaaagcgctgccgttgcagcaaaagaaagcaaaacttgcgtg
gtactgaatcccgcacctgcctgccctttgcccgatagtctattgcgctgtgtcgatgtg
atcaccccgaatgagaccgaagcagaagtgttaacgggcattaaagtaacggatgaggag
tctgctcagcaggcatcaaatgcactgcatgagaaaggtattgaaactgttttgatcacg
ttaggtgcgaaaggcgtctggcttagccagaacggtgtcggaaagggcatatccagttat
cgcgtagaagcggtagataccacagcagcaggggatacttttaacggtgcgttggtgact
gggctactggaaagcaaaccactggaatcagcaatccagttcgcaaacgctgcggcagcg
ctgtccgttactcgtttcggggcgcaaacctccattccaacaagaaaagaagtcgatgat
tttcttgcaaaacagttgaatacataa

DBGET integrated database retrieval system