KEGG   Vibrio nigripulchritudo: VIBNI_B0919Help
Entry
VIBNI_B0919       CDS       T02871                                 

Definition
Alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vni  Vibrio nigripulchritudo
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vni00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(940926..942326)
Genome map
AA seq 466 aa AA seqDB search
MKKSIKPSLAVIACLSIPTTASADAILHAFNWHYSDVTARAEQIAQAGYKKVLISPAMKS
RGDKWWARYQPLDFRVIDSPIGNKQDLQNMINALAQYNVDVYADVVMNHMANESLKQDGL
NYPGSDVIQDYQHRAGYYAAQTLYGDLSHNQYSSADFHPAGCITDWENPGHVQYWRLCGP
NGDTGLPDLEVNPWVKDQQRQYLAALKNMGVKGFRVDAVKHMSLHHINQIFTPQISANMH
IFGEVITGSGQGDSSYDGFLVPYLNGTNHSAYDFPLFSSIRRAFSYNGSMTLLHDPKAYG
QALESTRAITFTVTHDIPNNADFRHQILDPKDEELAYAYVLGRDGGVPLIYSDELPDSED
QDNGRWANVWNDSTMVKMLSFHNAMQGQGMTMVHSDQCTLLFKRGKQGVVGINKCGESKH
ITVDTYQHEFNWHMPYKDVLSGSTETVSSRYHTFELPPRSAKMLKL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccataaaaccatcactagcagtgattgcttgcctctccattcctacaaca
gcgtctgccgacgccattttgcacgcgtttaactggcattattccgatgtcactgcgcga
gcagaacaaatcgcacaggcaggctataaaaaggtgttgatttcccccgctatgaagtct
cgcggagacaaatggtgggcacgctatcagccgctcgatttccgggttatcgactccccc
ataggcaacaaacaagatttacaaaacatgatcaacgcactggctcagtacaatgttgat
gtttacgccgatgttgtgatgaatcacatggcgaacgagtcactcaaacaagatggactc
aactatccgggaagcgatgtcattcaggattaccaacatcgtgcgggttactacgctgcg
caaactctgtatggcgatttgagtcacaatcagtactcatctgccgatttccaccccgct
ggatgcattactgattgggaaaacccaggacacgtgcagtactggcgattatgtggacct
aacggagacactggtctaccagatctagaagtgaatccgtgggtgaaagaccaacaaaga
caatatcttgctgctctgaagaatatgggggttaaaggttttcgtgttgacgcggtaaaa
cacatgagccttcaccacatcaatcagattttcacaccgcagatctcagccaacatgcat
atttttggtgaagtcattaccggaagtggccagggtgattccagctacgacggattcctt
gtcccttacctgaacggcaccaatcactccgcgtacgatttcccgcttttttcttcaatc
cgacgcgctttctcttataacggaagtatgaccttgctgcatgatccaaaggcttacggt
caggcgttggaaagcacaagagcgattaccttcacagtcacccacgacattccaaacaat
gcggatttcagacatcaaatcttagatccaaaagatgaagaactggcttatgcctatgtt
ttagggcgtgatggtggcgtcccgctgatttacagtgacgagttgccagacagcgaagat
caggacaacggtcgttgggcaaacgtatggaatgattcaaccatggttaaaatgctcagc
ttccacaatgcgatgcagggacaaggaatgaccatggtgcatagtgaccaatgcacactg
ctgtttaaacggggtaagcaaggtgtggttggcattaacaaatgtggagaaagcaagcat
ataactgtagacacctatcaacacgaatttaactggcacatgccatataaagacgtactt
tcaggatcaacagaaacggtaagctcgcgttatcacacgtttgaactgccaccccgttct
gcaaagatgcttaaattgtag

DBGET integrated database retrieval system