KEGG   Vibrio nigripulchritudo: VIBNI_B1510Help
Entry
VIBNI_B1510       CDS       T02871                                 

Definition
Alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vni  Vibrio nigripulchritudo
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vni00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VIBNI_B1510
Enzymes [BR:vni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VIBNI_B1510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1541989..1543323)
Genome map
AA seq 444 aa AA seqDB search
MEQGERANAILHVFDWTYREVAEHASEIKSLGYRSVMVSPPLKSMKSDRGKYWWQRYQPQ
DYRVIDNPLGNTLDFKAMMAELHCHDLWVYVDVVFNHMANESDIRSDLQFPSDADIQEYQ
SNSEFYSELRLFGDLSVPLFTERDFIEPFGIVDWQDQWEVQNGRISSGPADPGLPTLSDN
SHVIEQQRLYLKAMKEMGVRGFRIDAAKHISLSHLEKVWTPDITEGMHIFGEIITDGGAT
RQEYEVFLKPYLEKTQLAAYDFPLFNTLFNALADKGSFESLVNPYALGQALSNPRAVTFA
TTHDIPNNHVFEDLVMSESSEWLAYAYILGRDGGVPLIYAEPPERTFSEKENISRWAENW
RSQKMKSLLDFHNSTYGHQMKVEFVDKDVIIISRGKVGLIALNKGKNIKSVDELLVSNTS
IDYDFKCISESLEIKPNSYLIVYL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaggtgaaagagccaatgccatcctgcacgtatttgattggacttaccgagaa
gttgcagaacatgcgtcagagataaagtctctggggtatcggtctgtcatggtttctccc
ccgttaaaatcgatgaaatctgaccgcggaaagtactggtggcagcgctatcagcctcag
gattatcgtgtaatagacaatccacttggcaatactctcgattttaaagctatgatggcg
gagctccactgccacgatctctgggtttatgtggacgtagtgtttaatcacatggccaac
gaatcggatattcgcagcgacttacaatttccttccgatgcagatatacaagaataccaa
tcaaattcggagttctattctgagctgagactgttcggcgatctatctgtccctcttttt
actgagcgagattttatcgagccttttggtattgtcgactggcaagatcagtgggaagta
caaaacggaagaatcagcagtggaccggctgacccgggtttaccaacattatcggataat
tcgcacgtcattgagcagcaaagactctatctaaaagcgatgaaagagatgggagtacgc
ggttttcgtattgatgccgccaaacacatcagcctcagtcatctggaaaaggtttggacg
ccagacatcacagaaggcatgcatatcttcggagaaatcatcacagatggtggcgcaact
cgtcaggaatacgaagtcttcctcaaaccttacctggaaaaaacgcagcttgcggcgtac
gactttccactcttcaacacactttttaatgcactagctgacaaaggcagtttcgaatct
ctggtcaacccttatgcgttggggcaggctctgtctaacccaagggctgtcacttttgcg
accactcacgacattccaaataatcacgtgtttgaagatttggtgatgtcagagtcaagc
gaatggctggcttatgcctatattcttggacgtgatggtggggtaccgctgatttatgct
gagccaccagagcgaactttttcagaaaaagagaatatatctcgttgggcggaaaactgg
cgcagccaaaaaatgaaatcattattggattttcacaactcgacttacggtcatcaaatg
aaagtcgaatttgtagataaagatgtcattataatttccagaggtaaagtagggttaata
gcactaaacaaaggtaaaaatataaaatctgttgatgaactattagtgagtaatacatca
attgattatgattttaaatgcatttccgaatctcttgaaattaaaccgaatagctactta
attgtctatctatga

DBGET integrated database retrieval system