KEGG   Vibrio nigripulchritudo: VIBNI_B1512Help
Entry
VIBNI_B1512       CDS       T02871                                 

Definition
putative Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vni  Vibrio nigripulchritudo
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:vni01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vni01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1543600..1544730
Genome map
AA seq 376 aa AA seqDB search
MSETESKPPLIWLNVSVFSISMLLAVVGAPLYGYAFGYGWEHAFWLVLTFSFCNLSITAG
YHRLWSHKAYDAHPVVRFVFALGGAFALQNSALHWSSDHRVHHRHVDINDKDPYSAKRGF
WFSHIGWMLRHYNKATYSDYSNCRDLQKDPIVMWQHKYYVPLAILMNLGVPVLLGLIHGD
VWGMLLVVGAVRLVLNHHTTFFINSLAHIWGSQPYTDKNTARDNGFLAFLTFGEGYHNYH
HIFENDYRNGIHWWQYDPTKWMIRLFSFVGLASRLTRCPPIRIERAKIQMQLRRARAQLQ
NRPQSATLLSSLQAEYDLLWKQMQEYYEVKKQLMEAKKTDLTRKYEASLLKIRYQQVRHT
LKLKKQNWNRLVAEYA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccgaaagcaaacctcctctgatatggctgaatgtcagcgtattttctatc
agtatgcttctggctgttgtcggtgctcccctatacggctatgcctttggttacggatgg
gaacacgccttttggctggtactgacttttagcttttgtaacctctccatcactgccgga
taccatcgcctttggtctcataaagcttatgatgctcatccagtagtgagatttgtgttt
gcgttaggcggcgcgtttgctctccagaacagcgcattacattggtcttcagatcaccgg
gtgcatcaccgtcatgtcgatatcaacgacaaagatccgtactctgccaagcgcggattc
tggttctcacacattggctggatgctcagacattacaacaaagccacctactccgactac
tccaattgccgcgacttacagaaagaccccatcgtaatgtggcagcataagtactacgtg
ccccttgccattcttatgaatctgggcgttccagtcctgcttggattaatacatggagac
gtatggggaatgctattggtcgtgggtgccgttcgtctggtactgaatcatcacactacg
ttctttatcaattctctggcccatatttggggcagccagccttatacagataaaaatacc
gcgcgagacaacggttttcttgcctttctgacgttcggtgaggggtatcacaactaccac
catatcttcgaaaatgactaccgtaatggcattcactggtggcaatacgatccaaccaaa
tggatgattcgcctgttttcgtttgttgggttggcaagccggttaactcgatgcccgcca
attcgaattgaacgggcaaaaattcagatgcagctaagaagagccagagctcagcttcag
aacagacctcaatcggcgacgttactcagttcgttgcaagccgagtacgatctcttgtgg
aaacaaatgcaggaatattatgaggtgaagaagcaattgatggaggcgaaaaagactgat
ctgacgagaaagtacgaagcctcactgctcaagattcgataccagcaggttcgccatact
ctaaagcttaaaaagcagaactggaaccggctcgtggcggaatacgcctag

DBGET integrated database retrieval system