KEGG   Vibrio nigripulchritudo: VIBNI_B1512Help
Entry
VIBNI_B1512       CDS       T02871                                 

Definition
putative Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vni  Vibrio nigripulchritudo
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vni00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VIBNI_B1512
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VIBNI_B1512
Enzymes [BR:vni01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     VIBNI_B1512
Lipid biosynthesis proteins [BR:vni01004]
 Desaturase
  First
   VIBNI_B1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1543600..1544730
Genome map
AA seq 376 aa AA seqDB search
MSETESKPPLIWLNVSVFSISMLLAVVGAPLYGYAFGYGWEHAFWLVLTFSFCNLSITAG
YHRLWSHKAYDAHPVVRFVFALGGAFALQNSALHWSSDHRVHHRHVDINDKDPYSAKRGF
WFSHIGWMLRHYNKATYSDYSNCRDLQKDPIVMWQHKYYVPLAILMNLGVPVLLGLIHGD
VWGMLLVVGAVRLVLNHHTTFFINSLAHIWGSQPYTDKNTARDNGFLAFLTFGEGYHNYH
HIFENDYRNGIHWWQYDPTKWMIRLFSFVGLASRLTRCPPIRIERAKIQMQLRRARAQLQ
NRPQSATLLSSLQAEYDLLWKQMQEYYEVKKQLMEAKKTDLTRKYEASLLKIRYQQVRHT
LKLKKQNWNRLVAEYA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccgaaagcaaacctcctctgatatggctgaatgtcagcgtattttctatc
agtatgcttctggctgttgtcggtgctcccctatacggctatgcctttggttacggatgg
gaacacgccttttggctggtactgacttttagcttttgtaacctctccatcactgccgga
taccatcgcctttggtctcataaagcttatgatgctcatccagtagtgagatttgtgttt
gcgttaggcggcgcgtttgctctccagaacagcgcattacattggtcttcagatcaccgg
gtgcatcaccgtcatgtcgatatcaacgacaaagatccgtactctgccaagcgcggattc
tggttctcacacattggctggatgctcagacattacaacaaagccacctactccgactac
tccaattgccgcgacttacagaaagaccccatcgtaatgtggcagcataagtactacgtg
ccccttgccattcttatgaatctgggcgttccagtcctgcttggattaatacatggagac
gtatggggaatgctattggtcgtgggtgccgttcgtctggtactgaatcatcacactacg
ttctttatcaattctctggcccatatttggggcagccagccttatacagataaaaatacc
gcgcgagacaacggttttcttgcctttctgacgttcggtgaggggtatcacaactaccac
catatcttcgaaaatgactaccgtaatggcattcactggtggcaatacgatccaaccaaa
tggatgattcgcctgttttcgtttgttgggttggcaagccggttaactcgatgcccgcca
attcgaattgaacgggcaaaaattcagatgcagctaagaagagccagagctcagcttcag
aacagacctcaatcggcgacgttactcagttcgttgcaagccgagtacgatctcttgtgg
aaacaaatgcaggaatattatgaggtgaagaagcaattgatggaggcgaaaaagactgat
ctgacgagaaagtacgaagcctcactgctcaagattcgataccagcaggttcgccatact
ctaaagcttaaaaagcagaactggaaccggctcgtggcggaatacgcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system