KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0025Help
Entry
COSY_0025         CDS       T00530                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
vok00900  Terpenoid backbone biosynthesis
vok01100  Metabolic pathways
vok01110  Biosynthesis of secondary metabolites
vok01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vok00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    COSY_0025 (dxr)
Enzymes [BR:vok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     COSY_0025 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Semialdhyde_dh NmrA
Motif
Other DBs
NCBI-ProteinID: BAF61164
UniProt: A5CY29
Position
complement(26989..28140)
Genome map
AA seq 383 aa AA seqDB search
MKNITLLGATGSIGKSTLSVVDLHPDKFNIFALSANTNWKQMIKLCNKYQPSYAIMVDEQ
SAEKLSNAITTDIQVLSSVQALDKIVTHQDTDYVMAAIVGAIGMSSALCGAKAGKRIMLA
NKESLVLAGDIFMKTVKEFNAELIPVDSEHSAIFQCLKSGKSGLNKIQLTASGGPFLHTP
ISQFKSITPDEACAHPNWSMGRKISVDSATMMNKGLEVIEAHYLFSLTPKQIDVVIHPQS
IVHSSVFYKDGSTLSQLGNPDMRTVIAYAMSYPKRMNSGVSELDLTSTASLEFYQPDFEK
FTCLKLAFEALNKGGNAMITMNAANEIAVKYFLNHQISFLDIPKIIDQTLSTMKHTTLNS
LEEVINNDLIAREIAHEIIKQYG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacataaccttacttggagcaactggttctatcggaaaatccacgctatctgtg
gtagatctacatcctgataaatttaatatttttgctctaagcgctaacactaactggaaa
caaatgattaagttatgcaataaatatcaaccaagttatgccattatggtagatgaacaa
tctgctgaaaaattatcaaatgctatcactactgatatccaagtacttagtagtgttcaa
gctttggataaaattgttactcatcaagatactgactatgttatggctgctatcgtcggc
gctattggtatgtcctcagcactttgtggtgccaaagctggcaagagaattatgcttgca
aataaagaatcattagtattagcaggtgatatttttatgaaaacagtaaaagaatttaat
gccgaactgattcctgttgattcagaacacagtgcaatttttcagtgcctaaaaagtggc
aaatcaggattaaataaaattcaactaactgctagtggtggaccgttcttacacacacca
attagccaatttaaatccatcactccagatgaggcctgtgcacacccgaactggtcaatg
ggacgtaaaatttcagttgattctgctactatgatgaacaaaggactagaagtaattgaa
gctcattatttattttcactcacaccaaaacaaattgatgtggttatacacccacaaagc
attgttcattcatcagtcttttacaaagatggttcaacactatctcaactaggaaatcca
gatatgcgtacagttattgcatatgcaatgagttatccaaaacgcatgaactctggcgtt
tctgaacttgacttaactagcacagcttccttagaattttaccaaccagattttgaaaaa
tttacttgtcttaaactagcatttgaagcacttaacaaaggtggtaacgccatgattact
atgaatgcagctaatgaaattgcagttaaatattttcttaaccaccaaattagtttttta
gatataccgaaaatcatcgaccaaacactaagcactatgaaacacacaacactaaactct
ttagaagaagtaattaacaatgatcttattgctcgtgaaatagctcatgaaattatcaaa
cagtatgggtag

DBGET integrated database retrieval system