KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0098Help
Entry
COSY_0098         CDS       T00530                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
vok00010  Glycolysis / Gluconeogenesis
vok00030  Pentose phosphate pathway
vok00051  Fructose and mannose metabolism
vok00052  Galactose metabolism
vok00680  Methane metabolism
vok01100  Metabolic pathways
vok01110  Biosynthesis of secondary metabolites
vok01120  Microbial metabolism in diverse environments
vok01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vok00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COSY_0098 (pfkA)
   00030 Pentose phosphate pathway
    COSY_0098 (pfkA)
   00051 Fructose and mannose metabolism
    COSY_0098 (pfkA)
   00052 Galactose metabolism
    COSY_0098 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    COSY_0098 (pfkA)
Enzymes [BR:vok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     COSY_0098 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     COSY_0098 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Cu-oxidase_4
Motif
Other DBs
NCBI-ProteinID: BAF61234
UniProt: A5CXT5
Position
complement(107449..108693)
Genome map
AA seq 414 aa AA seqDB search
MKNAFYAQSGGVTAVINASACGVIETARKHSNTIGTVYAGKNGIIGALTENLIDTSKESS
ADIKALKHTPSGGFGSCRYKMKSLETNKAEYERLIEVFKAHNIGYFFYNGGGDSADTCLK
VSQLSESMGYPIQAIHIPKTVDNDLPITDNSPGFGSVAKYIAVSTMEASFDVASMAATST
KIFVLEVMGRHAGWIASAGGLVDDSIPVVILFPEVGFDEKKFLAKVDKNVKEFGYCTIVV
SEGAKWPDGRFLSEQNTHDDFGHAQLGGVAPIIAKLIKNALGYKYHWAVADYLQRAARHL
ASKSDVKQAYALGQAAINMALEGKNSVMPTIIRTSNNPYTWKIGSGKLKDIANIEKMMLM
NYISNDGFGITEACREYLQPLIEGEDYPPYKNGLPDYVVMKKLMVDKKLPPFGV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgctttttatgcacaatcagggggggtgactgctgtaattaatgcatcagct
tgtggtgtaattgaaacagcgcgtaaacattcaaatacaatcggtacagtttatgcaggt
aaaaacggtattatcggtgcgttaactgaaaatttaatagatacttcaaaagaatctagt
gccgatattaaagccttaaaacacacaccttctggtggcttcggctcttgtcgttataaa
atgaaatctttagaaacaaacaaagcagaatacgaaagactaatcgaagtttttaaagca
cataatattggctattttttttacaacggtggtggcgattcagcagatacttgtttaaaa
gtttctcaattatctgaatcaatgggctacccaattcaagctattcacatacccaaaaca
gtcgataacgacttaccaattacagacaattctccaggttttggatcagtagctaaatat
attgctgtttctactatggaagctagttttgacgttgcttcaatggcagcaacttcaact
aaaatatttgtccttgaagttatgggtcgtcatgcaggttggattgcatcagcaggtggt
ttagttgatgactctatccctgtcgtgattttattcccagaagttggttttgatgaaaaa
aaattcttagctaaagttgataaaaatgtcaaagaatttggctactgcacaattgttgta
tcagaaggtgcaaaatggccagatggtcgtttcctatcagagcaaaatacacacgatgat
tttggtcatgctcagcttggtggcgtagcacctattattgctaaattaattaaaaatgcc
ttaggttataagtaccactgggcagttgcagattacttgcaacgtgctgctcgtcactta
gcctcaaaatccgatgttaaacaagcatatgcattaggtcaggcagctattaacatggca
cttgaaggtaaaaactcagtcatgcctactattattagaacatcaaataatccttatact
tggaaaattggttcaggcaaattaaaagatattgccaacattgaaaagatgatgcttatg
aactatatttctaacgacggctttggtattactgaggcttgtcgtgaatatttacaacca
cttatcgaaggtgaagactatccaccatacaaaaatggtttacctgattatgtagtaatg
aaaaaattaatggtggataaaaaattacctccattcggagtttaa

DBGET integrated database retrieval system