KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0098Help
Entry
COSY_0098         CDS       T00530                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vok00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COSY_0098 (pfkA)
   01230 Biosynthesis of amino acids
    COSY_0098 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COSY_0098 (pfkA)
   00030 Pentose phosphate pathway
    COSY_0098 (pfkA)
   00051 Fructose and mannose metabolism
    COSY_0098 (pfkA)
   00052 Galactose metabolism
    COSY_0098 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    COSY_0098 (pfkA)
Enzymes [BR:vok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     COSY_0098 (pfkA)
Protein phosphatases and associated proteins [BR:vok01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     COSY_0098 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(107449..108693)
Genome map
AA seq 414 aa AA seqDB search
MKNAFYAQSGGVTAVINASACGVIETARKHSNTIGTVYAGKNGIIGALTENLIDTSKESS
ADIKALKHTPSGGFGSCRYKMKSLETNKAEYERLIEVFKAHNIGYFFYNGGGDSADTCLK
VSQLSESMGYPIQAIHIPKTVDNDLPITDNSPGFGSVAKYIAVSTMEASFDVASMAATST
KIFVLEVMGRHAGWIASAGGLVDDSIPVVILFPEVGFDEKKFLAKVDKNVKEFGYCTIVV
SEGAKWPDGRFLSEQNTHDDFGHAQLGGVAPIIAKLIKNALGYKYHWAVADYLQRAARHL
ASKSDVKQAYALGQAAINMALEGKNSVMPTIIRTSNNPYTWKIGSGKLKDIANIEKMMLM
NYISNDGFGITEACREYLQPLIEGEDYPPYKNGLPDYVVMKKLMVDKKLPPFGV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgctttttatgcacaatcagggggggtgactgctgtaattaatgcatcagct
tgtggtgtaattgaaacagcgcgtaaacattcaaatacaatcggtacagtttatgcaggt
aaaaacggtattatcggtgcgttaactgaaaatttaatagatacttcaaaagaatctagt
gccgatattaaagccttaaaacacacaccttctggtggcttcggctcttgtcgttataaa
atgaaatctttagaaacaaacaaagcagaatacgaaagactaatcgaagtttttaaagca
cataatattggctattttttttacaacggtggtggcgattcagcagatacttgtttaaaa
gtttctcaattatctgaatcaatgggctacccaattcaagctattcacatacccaaaaca
gtcgataacgacttaccaattacagacaattctccaggttttggatcagtagctaaatat
attgctgtttctactatggaagctagttttgacgttgcttcaatggcagcaacttcaact
aaaatatttgtccttgaagttatgggtcgtcatgcaggttggattgcatcagcaggtggt
ttagttgatgactctatccctgtcgtgattttattcccagaagttggttttgatgaaaaa
aaattcttagctaaagttgataaaaatgtcaaagaatttggctactgcacaattgttgta
tcagaaggtgcaaaatggccagatggtcgtttcctatcagagcaaaatacacacgatgat
tttggtcatgctcagcttggtggcgtagcacctattattgctaaattaattaaaaatgcc
ttaggttataagtaccactgggcagttgcagattacttgcaacgtgctgctcgtcactta
gcctcaaaatccgatgttaaacaagcatatgcattaggtcaggcagctattaacatggca
cttgaaggtaaaaactcagtcatgcctactattattagaacatcaaataatccttatact
tggaaaattggttcaggcaaattaaaagatattgccaacattgaaaagatgatgcttatg
aactatatttctaacgacggctttggtattactgaggcttgtcgtgaatatttacaacca
cttatcgaaggtgaagactatccaccatacaaaaatggtttacctgattatgtagtaatg
aaaaaattaatggtggataaaaaattacctccattcggagtttaa

DBGET integrated database retrieval system