KEGG   Candidatus Vesicomyosocius okutanii: COSY_0110Help
Entry
COSY_0110         CDS       T00530                                 

Gene name
cysQ
Definition
sulfite synthesis pathway protein CysQ (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
vok  Candidatus Vesicomyosocius okutanii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:vok00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(120490..121272)
Genome map
AA seq 260 aa AA seqDB search
MRYDNIAMFDLLIPKLIRMTTKVGDMIMSLYENELNIKIKSNKTPFTIADKNAHKLIVKT
LSKLTPNTPIISEESEIIEFSERSKWCEYWIIDPLDGTRDFLKQTDEFCICIAYIKKHKP
IFGMIYAPPRKTHYYTTDANKVFKQQKNIIQPLNVRPNHNPLRVVIGHWSSHNKQLKDHL
KKYSTYKLSQLGSALKFCAIAEGKYDYYPKFGPCSEWDTAAGVCILQNAGGSVVNQNEKP
LSYNTKNDLTSPIFFASNKP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagatatgataatatagctatgtttgatttactcataccaaaactaattagaatgacc
acgaaagttggcgatatgattatgtcactatacgagaatgaacttaatattaaaatcaaa
tcaaacaaaacaccatttaccattgctgataaaaacgcacataaactcattgttaaaaca
ctatcaaaacttacgccaaatacacctataatttcggaggaatctgaaataattgaattt
tctgagcgctctaaatggtgtgaatattggataattgacccacttgacggtactcgtgat
tttctcaagcaaacagatgagttttgtatttgtattgcttatataaaaaaacacaaacca
atatttggtatgatttacgcaccgccaagaaaaacacactactatacaacagatgcaaac
aaagtattcaaacaacaaaagaatattattcaaccattaaatgtacgtcctaatcacaac
cctttaagagttgtgattggtcattggtcatcacacaataaacaattaaaagaccattta
aaaaaatacagcacatataagttatcacaattgggtagtgcgctaaaattttgtgctatt
gcagaaggtaaatatgactattacccaaaatttggcccttgttctgaatgggatactgct
gctggcgtatgtattctacaaaatgccggaggcagtgttgttaatcagaatgaaaagcct
ctcagttacaatactaaaaatgatttaactagtcctattttctttgcctcaaataaacct
taa

DBGET integrated database retrieval system